KEGG   Equus caballus (horse): 100049811Help
Entry
100049811         CDS       T01058                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb00565  Ether lipid metabolism
ecb00590  Arachidonic acid metabolism
ecb00591  Linoleic acid metabolism
ecb00592  alpha-Linolenic acid metabolism
ecb01100  Metabolic pathways
ecb04014  Ras signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100049811
   00565 Ether lipid metabolism
    100049811
   00590 Arachidonic acid metabolism
    100049811
   00591 Linoleic acid metabolism
    100049811
   00592 alpha-Linolenic acid metabolism
    100049811
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100049811
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100049811
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100049811
    3.1.1.32  phospholipase A1
     100049811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N NLPC_P60 Peptidase_C97
Motif
Other DBs
NCBI-GeneID: 100049811
NCBI-ProteinID: XP_023510028
Ensembl: ENSECAG00000019777
Position
12
AA seq 162 aa AA seqDB search
MRSPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVIHLAPPSEIAGAGAASIMSTLTDKAIV
KKELLYDVAGRDKYQVNNKHDDKYSPLPPSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVPRSDQVRDAIMAAGIAGVGLAAVGLIGVLFSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgcccatcccggagcccaagcctggagacctgattgaaattttccgccctttc
tacagacactgggccatctacgttggcgatggatatgtgatccacctggcccccccaagt
gaaatcgcgggagctggtgcggccagcatcatgtctaccctgactgacaaggccatagtg
aagaaggaactgctgtatgatgtggccgggagggacaagtaccaggtcaataacaaacac
gatgacaagtactcgccgctgcctcccagcaaaatcatccagcgggcggaggagctggtg
gggcaggaggtgctgtacaagctgaccagtgagaactgcgagcactttgtgaacgagctg
cgctacggagtgccccgcagcgaccaggtcagagacgccatcatggcagctggcatcgca
ggagtgggcctggcagctgtgggcctcattggagtcttgttctcaagaaacaagcgacaa
aagcaataa

DBGET integrated database retrieval system