KEGG   Equus caballus (horse): 100049826Help
Entry
100049826         CDS       T01058                                 

Gene name
PADI4
Definition
(RefSeq) protein-arginine deiminase type-4 isoform X1
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100049826 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N DUF5065
Motif
Other DBs
NCBI-GeneID: 100049826
NCBI-ProteinID: XP_023491420
Ensembl: ENSECAG00000011196
Position
2
AA seq 666 aa AA seqDB search
MAQGTVIHVAPEQPTYAVCVLGTDTQLDVYGSAPKGYTSFSINASPGVAVDVAHSPPAKK
NATGSPNWPLDPGLEVTLRMRTASHSTGDQKVQISYYGPKSNLVQALLYVTGVEITLSAD
ITRTGQVKPTRATKNQRTWTWGPRGQGAILLVNCDKDNPQSSTLDYEDDEVLDSKELEDM
SLVTLSTKTPRDFFSTHQLVLHVAKSEMDKVRVFRIHRDKQRSRYKVVLGPQQPSHALEL
PGGQHSVDFHVEGLAFPDASFSGLVSLTVSLLGASKPEFPKALVFQDSVAFRVAPWIMTP
NTQPPEEVYVCRVLENEDFLKSVSALAKKAKCKLTVCSEEENQDDQWMQDEMEVGYIQAP
HKTLPVVFDSPRNRGLKEFPIKCVRGPDFGYVTRGAQTEEITDLDSFGNLEVSPPVTVAG
KTYPLGRVLIGSSSYPSHESQEMHQALRDFLVAQQVQAPVELYSDWLYVGHVDEFMTFVP
VHKKGFRLLLASPRSCYKLFQELLKEGHGEALLFEGVTKRKRQKIKDILSNKKLREQNSY
VESCIDWNREVLKRELGLTERDIIDIPQLFKLQQDSKGTHKAEALFPNMVNMLVLGKHLG
IPKPFGPVIHGRCCLEEKVRSLLEPLGLHCTFIDDFSSYHVRHGEVHCGTNVRRQPFAFK
WWHMVP
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggacagtgatccatgtggccccagagcagcccacctacgccgtgtgtgtg
cttggcaccgacactcagttggatgtctacggctctgcccccaagggctacacatccttc
agcatcaatgcttccccgggagtggccgtagatgttgcccacagccctccagccaagaag
aatgccacaggttcccccaactggcccctggaccctgggctggaggtgaccctgaggatg
agaactgccagccacagcacaggtgaccagaaggttcagatttcatactacggacccaag
agtaacctggtccaagccctgctgtatgtcaccggggttgaaatcaccttgagcgcggac
atcacccgcaccggccaggtgaagccaaccagagccacgaagaaccagaggacctggacc
tggggccctcgtgggcaaggcgccatcctgctggtgaactgtgacaaagacaatccccag
tcttccaccttggactatgaggatgacgaggtgcttgacagcaaagagctggaggacatg
tccctggtgaccctgagcacaaagacccccagggacttcttctccacgcatcagctggtg
ctccacgtggccaaatctgagatggacaaagtcagggtgttccgcatccatcgggacaaa
cagcggtccaggtacaaggtggtcctggggccgcagcagccgtctcacgccctggagctc
ccgggcggccagcacagcgtggacttccacgtggagggcctcgccttcccggacgccagc
ttctcagggctcgtctccctcaccgtctccctgctgggcgcgtccaaaccggagttcccc
aaggccctggttttccaggacagcgtggccttccgtgtggccccctggatcatgaccccc
aacacccagcccccagaggaggtgtacgtgtgcagggtactggaaaatgaggacttcctg
aagtcggtgagtgctctggccaagaaggccaagtgcaagctgactgtgtgctccgaggag
gagaaccaggacgaccagtggatgcaggatgagatggaagtgggctacatccaggccccg
cacaaaacgctgcccgtggtctttgactccccgaggaacagaggcctgaaggagttcccc
atcaaatgcgtgcggggtccagattttggctacgtgactcgaggggcccagacagaggag
attaccgacctcgactccttcggcaacctggaagtgagcccgcccgtcacggtcgcgggg
aagacgtaccccctgggcagggttctcatcgggagcagcagttaccccagccacgagagc
caggagatgcaccaggccctgcgggacttcctggtcgcccagcaggtgcaggcgcccgtg
gagctctactccgactggctgtacgtgggccacgtggacgagttcatgaccttcgttccc
gtgcacaagaagggcttccggctgcttctggccagccccaggtcctgctacaaactgttc
caggagctgctgaaggagggccacggggaggcgctgcttttcgaaggagtcactaaaaga
aaacggcagaaaataaaggacattctgtcaaacaagaaattgagagaacagaattcatac
gtggagagctgcatcgactggaaccgggaggtgctgaagcgggagctgggcctgacggag
cgggacatcatcgacatccctcagctcttcaagctccagcaggactccaaagggacacac
aaggctgaagcccttttcccaaacatggtgaacatgcttgtgctgggcaagcacctgggc
atccccaagcccttcgggcccgtcatccacggccgctgctgcctggaggagaaggtgcgg
tccctgctggagcctctgggcctccactgcaccttcatcgacgacttctcctcctaccac
gtccggcacggcgaggtccactgcggcaccaacgtgcgccggcagccgtttgccttcaag
tggtggcacatggtgccctga

DBGET integrated database retrieval system