KEGG   Equus caballus (horse): 100049826Help
Entry
100049826         CDS       T01058                                 

Gene name
PADI4
Definition
peptidyl arginine deiminase, type IV
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 667 aa AA seqDB search
MAQGTVIHVAPEQPTYAVCVLGTDTQLDVYGSAPKGYTSFSINASPGVAVDVAHSPPAKK
NATGSPNWPLDPGLEVTLRMRTASHSTGDQKVQISYYGPKSNLVQALLYVTGVEITLSAD
ITRTGQVKPTRATKNQRTWTWGPRGQGAILLVNCDKDNPQSSTLDYEDDEVLDSKELEDM
SLVTLSTKTPRDFFSTHQLVLHVAKSEMDKVRVFRIHRDKQRSRYKVVLGPQQPSHALEL
PGGQHSVDFHVEGLAFPDASFSGLVSLTVSLLGASKPVGPDTVVFRPSVSLRAWPRPWPG
LQSTEELLWCSFXVLENEDFLKSVSALAKKAKCKLTVCSEEENQDDQWMQDEMEVGYIQA
PHKTLPVVFDSPRNRGLKEFPIKCVRGPDFGYVTRGAQTEEITDLDSFGNLEVSPPVTVA
GKTYPLGRVLIGSSSYPSHESQEMHQALRDFLVAQQVQAPVELYSDWLYVGHVDEFMTFV
PVHKKGFRLLLASPRSCYKLFQELLKEGHGEALLFEGVTKRKRQKIKDILSNKKLREQNS
YVESCIDWNREVLKRELGLTERDIIDIPQLFKLQQDSKGTHKAEALFPNMVNMLVLGKHL
GIPKPFGPVIHGRCCLEEKVRSLLEPLGLHCTFIDDFSSYHVRHGEVHCGTNVRRQPFAF
KWWHMVP
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggacagtgatccatgtggccccagagcagcccacctacgccgtgtgtgtg
cttggcaccgacactcagttggatgtctacggctctgcccccaagggctacacatccttc
agcatcaatgcttccccgggagtggccgtagatgttgcccacagccctccagccaagaag
aatgccacaggttcccccaactggcccctggaccctgggctggaggtgaccctgaggatg
agaactgccagccacagcacaggtgaccagaaggttcagatttcatactacggacccaag
agtaacctggtccaagccctgctgtatgtcaccggggttgaaatcaccttgagcgcggac
atcacccgcaccggccaggtgaagccaaccagagccacgaagaaccagaggacctggacc
tggggccctcgtgggcaaggcgccatcctgctggtgaactgtgacaaagacaatccccag
tcttccaccttggactatgaggatgacgaggtgcttgacagcaaagagctggaggacatg
tccctggtgaccctgagcacaaagacccccagggacttcttctccacgcatcagctggtg
ctccacgtggccaaatctgagatggacaaagtcagggtgttccgcatccatcgggacaaa
cagcggtccaggtacaaggtggtcctggggccgcagcagccgtctcacgccctggagctc
ccgggcggccagcacagcgtggacttccacgtggagggcctcgccttcccggacgccagc
ttctcagggctcgtctccctcaccgtctccctgctgggcgcgtccaaaccggtaggccca
gatactgttgtttttaggcccagcgtctccctcagagcctggccgaggccgtggccggga
ctccagagcactgaggagcttctctggtgctctttctaggtactggaaaatgaggacttc
ctgaagtcggtgagtgctctggccaagaaggccaagtgcaagctgactgtgtgctccgag
gaggagaaccaggacgaccagtggatgcaggatgagatggaagtgggctacatccaggcc
ccgcacaaaacgctgcccgtggtctttgactccccgaggaacagaggcctgaaggagttc
cccatcaaatgcgtgcggggtccagattttggctacgtgactcgaggggcccagacagag
gagattaccgacctcgactccttcggcaacctggaagtgagcccgcccgtcacggtcgcg
gggaagacgtaccccctgggcagggttctcatcgggagcagcagttaccccagccacgag
agccaggagatgcaccaggccctgcgggacttcctggtcgcccagcaggtgcaggcgccc
gtggagctctactccgactggctgtacgtgggccacgtggacgagttcatgaccttcgtt
cccgtgcacaagaagggcttccggctgcttctggccagccccaggtcctgctacaaactg
ttccaggagctgctgaaggagggccacggggaggcgctgcttttcgaaggagtcactaaa
agaaaacggcagaaaataaaggacattctgtcaaacaagaaattgagagaacagaattca
tacgtggagagctgcatcgactggaaccgggaggtgctgaagcgggagctgggcctgacg
gagcgggacatcatcgacatccctcagctcttcaagctccagcaggactccaaagggaca
cacaaggctgaagcccttttcccaaacatggtgaacatgcttgtgctgggcaagcacctg
ggcatccccaagcccttcgggcccgtcatccacggccgctgctgcctggaggagaaggtg
cggtccctgctggagcctctgggcctccactgcaccttcatcgacgacttctcctcctac
cacgtccggcacggcgaggtccactgcggcaccaacgtgcgccggcagccgtttgccttc
aagtggtggcacatggtgccctga

DBGET integrated database retrieval system