KEGG   Equus caballus (horse): 100049831Help
Entry
100049831         CDS       T01058                                 

Gene name
RORB
Definition
RAR-related orphan receptor B
Orthology
K08533  
RAR-related orphan receptor beta
Organism
ecb  Equus caballus (horse)
Pathway
Circadian rhythm
Class
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:ecb04710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 470 aa AA seqDB search
MCENELKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQGGEAEALARVYSSSISNGLSNLNNEASGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELRQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCATVCK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagaacgagctcaaaactaaagctgatgccactgcacaaattgaagtgatacca
tgcaaaatttgtggcgataaatcctccgggatccactacggagtcatcacgtgtgaaggc
tgcaagggattctttaggaggagccagcagaacaatgcctcttactcctgcccaaggcag
agaaactgtttaattgacagaaccaacaggaaccgttgccaacactgccgactgcagaag
tgtcttgccctaggaatgtcgagagatgctgtgaagttcgggaggatgtccaagaagcaa
agggacagcctgtatgccgaggtgcagaagcaccagcagcggctgcaggagcagcggcag
cagcagggtggggaggcggaagcccttgccagggtgtatagcagcagcatcagcaatggc
ctcagcaacctgaacaatgaagccagcggcacatatgccaacggacatgtcattgacctg
cccaagtccgagggttattacaacgtggattccggccagccttcccctgatcagtcagga
cttgacatgactggaatcaaacagataaagcaagaacctatctatgacctcacatccgta
cccaacttgtttacctatagctctttcaacaacgggcagttagcaccagggataacaatg
actgaaatcgatcgaattgcacagaacatcattaagtcccatttggagacatgtcaatac
accatggaggagctgcgccagctggcatggcagacccacacctacgaagaaatcaaagcg
tatcaaagcaagtccagggaagcactgtggcagcaatgtgccatccagatcactcacgcc
atccaatacgtggtagagtttgcaaagcggataacaggcttcatggagctctgccaaaat
gatcaaattctacttctgaagtcaggttgcttggaagtggttttagtgagaatgtgccgt
gccttcaacccattaaacaacactgttctgtttgaaggaaaatatggaggaatgcaaatg
ttcaaggccttaggctctgatgacctagtgaatgaagcatttgactttgcaaagaatttg
tgttccttgcagctgaccgaggaggagattgctttgttctcatctgctgttctcatctct
ccagaccgagcctggctgatagaaccaaggaaggtccagaagcttcaggaaaaaatttat
tttgcacttcaacatgtgattcagaagaatcacctggatgatgagaccttggcaaagtta
atagccaagataccaaccatcacggcagtttgcaacttgcacggggagaaactgcaggta
tttaagcaatcgcatccagacatagtgaatacactctttcctccgttatacaaggagctc
tttaatcctgactgtgccaccgtctgcaaatga

DBGET integrated database retrieval system