KEGG   Equus caballus (horse): 100049831Help
Entry
100049831         CDS       T01058                                 

Gene name
RORB
Definition
(RefSeq) RAR related orphan receptor B
  KO
K08533  
RAR-related orphan receptor beta
Organism
ecb  Equus caballus (horse)
Pathway
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    100049831 (RORB)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100049831 (RORB)
Nuclear receptors [BR:ecb03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   100049831 (RORB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 459 aa AA seqDB search
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQGGEAEALAR
VYSSSISNGLSNLNNEASGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELRQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA
LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCATVCK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacaaattgaagtgataccatgcaaaatttgtggcgataaatcctccgggatc
cactacggagtcatcacgtgtgaaggctgcaagggattctttaggaggagccagcagaac
aatgcctcttactcctgcccaaggcagagaaactgtttaattgacagaaccaacaggaac
cgttgccaacactgccgactgcagaagtgtcttgccctaggaatgtcgagagatgctgtg
aagttcgggaggatgtccaagaagcaaagggacagcctgtatgccgaggtgcagaagcac
cagcagcggctgcaggagcagcggcagcagcagggtggggaggcggaagcccttgccagg
gtgtatagcagcagcatcagcaatggcctcagcaacctgaacaatgaagccagcggcaca
tatgccaacggacatgtcattgacctgcccaagtccgagggttattacaacgtggattcc
ggccagccttcccctgatcagtcaggacttgacatgactggaatcaaacagataaagcaa
gaacctatctatgacctcacatccgtacccaacttgtttacctatagctctttcaacaac
gggcagttagcaccagggataacaatgactgaaatcgatcgaattgcacagaacatcatt
aagtcccatttggagacatgtcaatacaccatggaggagctgcgccagctggcatggcag
acccacacctacgaagaaatcaaagcgtatcaaagcaagtccagggaagcactgtggcag
caatgtgccatccagatcactcacgccatccaatacgtggtagagtttgcaaagcggata
acaggcttcatggagctctgccaaaatgatcaaattctacttctgaagtcaggttgcttg
gaagtggttttagtgagaatgtgccgtgccttcaacccattaaacaacactgttctgttt
gaaggaaaatatggaggaatgcaaatgttcaaggccttaggctctgatgacctagtgaat
gaagcatttgactttgcaaagaatttgtgttccttgcagctgaccgaggaggagattgct
ttgttctcatctgctgttctcatctctccagaccgagcctggctgatagaaccaaggaag
gtccagaagcttcaggaaaaaatttattttgcacttcaacatgtgattcagaagaatcac
ctggatgatgagaccttggcaaagttaatagccaagataccaaccatcacggcagtttgc
aacttgcacggggagaaactgcaggtatttaagcaatcgcatccagacatagtgaataca
ctctttcctccgttatacaaggagctctttaatcctgactgtgccaccgtctgcaaatga

DBGET integrated database retrieval system