KEGG   Equus caballus (horse): 100049961Help
Entry
100049961         CDS       T01058                                 

Gene name
PADI1
Definition
(RefSeq) peptidyl arginine deiminase, type I
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100049961 (PADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 617 aa AA seqDB search
MALQRAVQLSSKKPTYAVCVVGVETHVDVHRWGGRAGLGLTMSPQVKVSYFGQHGGDALG
HGVLYLTGVDISLDVDTGRTGKVKRGQGDKKTWRWGPEGYGAVLLVNCDRDSLRSQGLDL
ADRQLTSLDDLQDMSPMVLSCDGPDKLFNSHKLVLNVPFSDSKRLRVFCARGGNSLSDYK
QVLGPQRLSYEVRRQPGERKVSFYVEGLTFPDADFLGLVSLSVSLVDTGTLPEVPLFTDT
VAFRMAPWIMTPNTQPPLELYVCSVRDSHGSNEKFLEDMSDLGLKANCRLIICPWIENRN
DRWIQDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREILLAGASGL
DAFGNLDVSPPVTVGGKEYPLGRVLIGSSFPKSGGRRMAKVVRDFLQAQQVQAPVELYSD
WLSVGHVDEFLSFVPTSDQKGFRLLLASPSACLKLFQEKKEQGYGEAAQFDGLEHQVKRS
INEMLADRRLQKDSLHIQKCIDWNREVLKRELGLTERDIIDIPQLFSLKDSYAEAFFPDM
VNMVVLGQHLGIPKPFGPVINGRCCLEEKVRSLLEPLGLHCTFIDDYLSYHKLLGEVHCG
TNVRRQPFAFKWWNTVP
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcagagggctgtgcagctgtcctcgaagaagcccacctacgccgtgtgtgtg
gtgggagtcgagacgcatgtggatgttcacaggtggggcggccgtgctggcttagggctg
accatgtccccgcaggtgaaggtctcctacttcgggcagcacgggggcgacgccctgggc
cacggcgtgctctatctcaccggcgtcgacatctccctcgacgtcgacacgggccgcacg
ggcaaggtgaagaggggccaaggagacaagaaaacctggcgctggggccctgagggctat
ggggctgtcctgctggtgaactgtgaccgggatagtctcaggtcccaggggctggacctc
gccgacaggcagctgacatcactggacgacctgcaggacatgtccccaatggtgctgagc
tgtgacggccctgacaagctcttcaacagccacaagctggtcctgaacgtgccattttct
gattccaaaagactgcgggtcttctgtgcgaggggtgggaattccctctcagactacaag
caagtgctggggccccagcgtttgtcctacgaggtcaggcggcagccgggggagcggaag
gtcagcttctacgtggagggcctcaccttccccgatgctgacttcttggggctggtctcc
ctcagcgtcagcctggtggacacggggaccctgccggaggtgcccctcttcacagacacc
gtggccttccgcatggccccctggatcatgacccctaacacccagccgcccctggagctg
tacgtgtgcagtgtgagagactctcatggctcaaatgagaaatttctggaagacatgtct
gacctggggttgaaagccaactgcaggctgatcatctgcccttggattgaaaatcgaaat
gaccgctggatccaggacgagatggagttcggctatatcgaggcccctcacaaatccttc
ccagtggtcttcgactccccccgaaacagaggcctgaaggatttcccctataagaggatc
ctgggtcccgactttggatacgtaactcgggagatcctgctggccggcgcctccggcctt
gatgccttcggcaacctggacgtcagcccgccggtgacagtgggtggcaaggagtacccc
ctgggccgggtcctcatcggcagcagcttccccaagtccggtgggaggcgaatggccaag
gtggtgcgggacttcctgcaggcccagcaggtacaggcgcccgtggagctctactccgac
tggctctccgtgggccacgtggacgagtttctgagctttgtgcccacctccgaccagaag
ggcttccggctgctcctggcgagccccagcgcttgcctcaaactgttccaagagaagaaa
gagcagggctacggggaggcggcccagtttgatgggttagagcaccaggtgaagagaagc
attaatgagatgctggcagacagacgcctccagaaggacagtctccacatccagaaatgc
attgactggaaccgggaggtgctgaagcgggaactgggcctgacggagcgggacatcatc
gacatcccccagctcttctccctgaaggactcctacgcagaagccttcttccccgacatg
gtcaacatggtggtcttgggccagcacctgggcatccccaagcccttcgggcccgtcatc
aatggccgctgctgcctggaggagaaggtgcggtccctgctggagccgctgggcctccac
tgcaccttcatcgatgactacttatcctaccacaagcttctcggggaggtccactgcggc
accaacgtgcgccggcagccctttgccttcaagtggtggaacacggtgccctga

DBGET integrated database retrieval system