KEGG   Equus caballus (horse): 100050025Help
Entry
100050025         CDS       T01058                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100050025 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 665 aa AA seqDB search
MLHERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSARVRVEVVRDGQAEE
VVTNGKQRWPLSPTTTLRLTMSQASTEASSDKVTVNYYDEEENTPVDQAGLFLTAIEISL
DVDADRDGVVEKNNPNKASWTWGPEGQGAILLVNCDRDTPWLPKEDCHDQKAYSKEDLKD
MSQMILRTKGPEHLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLRFPDEGFSGLVNIHVSLLEYMAEGIPLTPIFTDTVLFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYMNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKQLLGPDIGYVTREPLFETVTSLDSFGNLEVSPPVTVN
GKRYPLGRILIGSSFPLSGGRRMTKVVRDFLQAQQVQAPVELYSDWLTVGHVDEFMTFVP
IPETKQFLMLMASTSACYKLFREKQREGYGESIMFKGLGGMSSKRITINKILSSESLVQE
NQYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDENRQARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLETHVRSLLEPLGFCCTFVDDISAYHKFLGEVHCGTNVRRKPFAFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacgagcggacggtgcggctgcagtacggaagccgcgtggaggccgtgtacgtg
ctgggcacctacctctggaccgatgtctacagcgcagccccagccggggcccagaccttc
agcctgaagcactcggcgcgcgtgcgggtggaggtggtgcgtgacgggcaggccgaggaa
gtggtcaccaacggtaaacagcgctggcctctctcacccaccaccacgctgcggctcacc
atgagccaggcgagcaccgaggccagcagcgacaaggtcaccgtcaactactatgacgag
gaggagaatacccccgtcgaccaggccgggctcttcctcacggccattgagatctccctg
gatgtggatgcggaccgggacggcgtggtggagaagaacaacccgaataaggcatcctgg
acctggggccctgagggccagggggccatcctgctggtgaactgtgaccgcgacacgccc
tggttgcccaaggaggactgccacgaccagaaggcctacagcaaggaagacctcaaggac
atgtcccagatgatcctgaggaccaaaggcccggagcacctccccgccggatacgagata
gttctctacatttccatgtcggactcggacaaagtgggcgtgttctacgtggagaacccg
tttttcggccagcgttacatccacatcctgggccggcggaagctctaccacgtggtcaag
tacacgggcggctccgcggagctgctgttcttcgtggaaggcctgcgattccccgacgag
ggcttctccggcctggtcaacatccacgtcagcctgctggagtatatggccgaggggatt
ccgctgacacccatcttcacggacaccgtgctgttccggattgctccatggatcatgacc
cccaacatcctgcctcccgtgtcagtgtttgtgtgctgcatgaaggacaattacctgttc
ctcaaagaggtgaagaacctggttgagaaaaccaactgtgaactgaaggtttgcttccag
tacatgaaccgaggcgaccgctggatccaggatgaaattgagtttggctacatcgaggcc
ccccataaaggcttccccgtggtgctggactccccccgagatggaaacctgaaggacttc
ccagtgaagcaactcctgggcccagatatcggctatgtgacccgggagcccctctttgag
actgtcaccagccttgattcttttgggaacctggaggtcagtcccccagtgaccgtgaac
ggcaagagataccccctgggccggatcctcatcgggagcagctttcctctgtccggcggt
cggaggatgaccaaggtggtgcgggacttcctgcaggcccagcaggtgcaggcgcccgtg
gagctctactccgactggctgaccgtgggccacgtggacgagttcatgaccttcgtcccc
atcccggagacaaagcaattcctgatgctcatggccagcacctcggcctgctacaagctc
ttccgagagaagcagagagagggctatggggagtccatcatgttcaaaggcttgggcggg
atgagcagcaagcgcatcaccatcaacaagattttgtccagtgagagcctcgtgcaggag
aaccagtacttccagcgctgcctggactggaaccgcgacatcctcaagaaggagctcggg
ctgacagagcaggacatcatcgatctgcccgctctgttcaagatggatgagaaccgccag
gccagagccttcttcccgaatatggtgaacatgatcgtgctcgacaaggacctgggcatc
cccaagccgttcgggccgcaggtggaggaggagtgctgcctggagacgcacgtgcgctcc
ctgctggagcccctgggcttctgctgcaccttcgtcgacgacatttccgcctaccacaag
ttcctgggcgaggtccactgcggcaccaacgtccgcaggaagcccttcgccttcaagtgg
tggcacatggtgccctga

DBGET integrated database retrieval system