KEGG   Equus caballus (horse): 100050044Help
Entry
100050044         CDS       T01058                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ecb  Equus caballus (horse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100050044 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100050044 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100050044 (THBS2)
  Cell communication
   04510 Focal adhesion
    100050044 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100050044 (THBS2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100050044 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100050044 (THBS2)
  Exosomal proteins of bladder cancer cells
   100050044 (THBS2)
Heparan sulfate/heparin binding proteins [BR:ecb00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100050044 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
31
AA seq 1172 aa AA seqDB search
MLWTLLLLALWASSSTQAGDQDEDSTFDLFSVSNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVSADYLSKMAKIMRQKEGFFLMATLKQDRKSRGTLLALEGPGPSQRQFEIVSNGP
ADTLDLTYWIDGAQHVISLEDVGLADSQWKNITVQVTGETYSLYVGCDLIDSFTLDEPFY
EQLKTEKSRMYVAKGSVRESHFRGLLQNVYLGFENSVEDILSKKGCQQNQGAEANAINEN
TDTLHLSPQINTEYVGQSSEKRPEVCERSCEELGSMINELSGLHVIVNQLHENLRKVSND
NQFLWELIGGPPKTRNMSACWQDGRFFSENETWVVDSCTKCTCKKFKTVCHQITCPPATC
ANPSFIEGECCPSCFHSADGEEGWSPWAEWTECSATCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLGKCDNRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKSCKGSG
RETKACQGPPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDIKEH
QMCNKRSCPVDGCLSNPCFPGAECSSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDV
CFSTSKAHRCVNTNPGFHCLPCPPRYKGSQPFGVGLEAARTEKQVCEPENPCKDKTHSCH
KHAECIYLGVFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNC
PLLPNSGQEDFDKDGIGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDHDGQGDACDSDD
DNDGVPDDRDNCRLVSNPEQEDSDGDGRGDACKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggacgctgctcctgctggctctgtgggcctcgtccagcactcaagctggtgac
caggacgaggactctaccttcgaccttttcagcgtcagcaacataaaccggaagaccatc
ggggccaagcagttccgggggcctgaccccagcgtgccagcctatcgtttcgtccggttt
gactatattccaccggtgagtgcagattatctcagcaagatggccaagatcatgcggcaa
aaagagggcttcttcctcatggccaccctgaagcaggaccgcaagtccaggggtacgctc
ctggctctggagggccccggcccctcccagaggcagtttgagatcgtctccaacggccca
gcggacaccctggacctcacctactggatagatggcgcccagcacgtcatctccctggag
gacgtgggccttgctgactcccagtggaagaacatcaccgtgcaggtgacaggcgagacc
tacagcttgtacgtgggctgtgacctgatcgacagcttcactctggacgagcccttctat
gagcagctgaaaacggaaaagagcaggatgtacgtggccaaaggctctgttcgagagagt
cacttcaggggtttgctgcagaacgtctacttgggttttgaaaattctgtggaagatatt
ctaagcaagaaaggttgtcagcaaaaccagggagcggaagccaacgccatcaacgaaaac
acagacacgctgcacctgagcccccagatcaacacggagtacgtgggccagagctcggag
aagaggcccgaggtgtgtgagcgctcctgcgaggagctgggcagcatgatcaacgagctg
tcggggctgcatgtcatcgtgaaccagctgcacgagaacctgcgcaaagtgtcgaatgat
aaccagtttctctgggagctcattggcggccctccgaagacgaggaacatgtcggcttgc
tggcaggacggccggttcttttcggaaaatgaaacctgggtggtggacagctgcaccaag
tgtacctgcaagaaatttaaaaccgtttgccaccaaatcacctgccccccagcgacctgt
gccaacccgtccttcatcgaaggcgaatgctgtccgtcctgcttccactcagcagatggt
gaggagggctggtccccgtgggcagagtggaccgagtgttccgccacctgtgggtctggc
acccagcagaggggccggtcgtgtgacgtcaccagcaacacctgcttggggccgtccatc
cagacgcgggcatgcagcctgggcaaatgcgacaaccgcattcggcaggacggcggctgg
agccactggtcgccttggtcctcctgctccgtgacctgtggggtcggcaacatcacgcga
atccggctctgcaactcgccggtcccccagatggggggcaagagctgcaaagggagtggc
cgagagacaaaggcctgccagggtcccccctgcccgattgatgggcggtggagcccctgg
tccccgtggtcagcctgtacggtcacctgtgctggggggatccgggagcggacgcgtgtc
tgtaacagcccggagcctcagtacggagggaaggcctgcgtgggggacatcaaggagcat
cagatgtgcaacaagaggagctgccccgtagacggctgcttatccaacccctgctttccg
ggagctgagtgcagcagcttccccgatgggtcctggtcctgcggctcctgcccagtgggc
ttcctgggcaacggcacacactgcgaggacctggacgagtgtgccgtggtcacagatgtc
tgcttctccacgagcaaggcgcaccgctgcgtcaacaccaacccggggttccactgcctg
ccgtgcccccctcgctacaaaggcagccagcccttcggtgtcgggctggaggcggccagg
accgaaaagcaagtgtgtgagcctgaaaacccatgcaaggacaagacgcacagctgccac
aagcacgcagagtgcatctacctgggcgtcttcagcgaccccatgtacaagtgcgagtgc
cagacgggctacgcaggcgacgggctcatctgtggagaggactccgacctggacggctgg
cccaacaagaatctggtctgcgccaccaacgccacctaccactgcatcaaggacaactgt
cccctcctgcctaattctggacaagaagattttgacaaggacggcattggcgatgcctgc
gacgatgacgatgacaacgatggcgtcgatgatgagaaggacaactgccagcttctcttc
aacccccgtcaatttgactacgacaaagatgaggttggggatcgctgcgacaactgccct
tacgtgcacaaccccgctcagatcgacacggacaacaacggggagggtgacgcctgttcc
gtggacatcgacggagacgatgtcttcaacgagagagacaattgtccgtacgtctacaac
actgaccagagagacaccgacggcgatggcgtgggtgaccactgtgacaactgccccctg
gtgcacaaccccgaccagactgatgtggacaatgaccttgtgggagaccagtgtgacaac
aatgaagacatcgatgaggacggccaccagaacaaccaggacaactgcccttacatctcc
aacgccaaccaggccgaccatgaccacgatggccagggtgacgcctgtgactcggatgac
gacaacgacggggttcctgacgacagggacaactgccggctcgtgtcaaacccggagcag
gaggactcagatggtgatgggcggggcgatgcttgcaaggatgactttgacaatgacaac
atcccggatattgatgacgtgtgtcctgaaaacaatgccatcagtgagacggacttcagg
aacttccagatggtccacttggaccccaagggcaccactcagatcgatcccaactgggtc
attcgccatcaaggcaaggagctggtgcagacggctaactccgaccctggcatcgcagtc
ggttttgacgagtttgggtctgtggacttcagcggcacgttttacgtcaacactgaccgg
gacgacgattacgctggcttcgtctttggctaccagtccagcagccgcttctatgtggtg
atgtggaagcaggtcactcagacctactgggaagaccagcccacccgcgcgtacggctac
tcgggcgtgtccctcaaggtggtcaactccaccacggggacaggcgagcacctgaggaat
gccctgtggcatactgggaacacagagggacaggttcgtactttatggcatgaccctaaa
aatattggctggaaagactacaccgcctacaggtggcacctgacccacagacctaagacg
ggttatataagagtcttagtgcatgaaggaaaacaggtcatggcggattcaggacccatc
tacgaccaaacttacgcgggcgggcggctgggtctgtttgtcttctcccaagaaatggtc
tatttctcagacctgaaatacgaatgcagagatgtctaa

DBGET integrated database retrieval system