KEGG   Equus caballus (horse): 100050161Help
Entry
100050161         CDS       T01058                                 

Gene name
AURKA
Definition
aurora kinase A
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:ecb04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 404 aa AA seqDB search
MDRSKENCISGPVKTTVPLGDGPKRVPVTQQLPQNLLSANSGQAQRVLCPSNSSHRVPSQ
AQKLVSSHKPVQNLKQKQSQATSVPHPVPRPLNNTQRSEQLQPSAPGNNSEKELASKEKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITEL
ANALAYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDLI
SRLLKHNPSQRPTLKEVLEHPWITANSSKPSNSQKSKESTSKQP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacagatctaaagaaaactgcatttcagggcctgttaagactacagttccacttggt
gatggtccaaagcgtgttccggtgactcagcagttacctcagaatctgttatctgcaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcctcccaccgagttccttcgcaa
gcgcagaagcttgtctccagccataaaccagttcagaacctgaagcagaagcaatcgcag
gccaccagtgtccctcaccctgtccccaggccactgaataatacccaaaggagtgagcag
ctgcagccgtcagcccctggaaataattctgaaaaggaactggcatcaaaagagaaaaac
gaagaatcaaaaaaaaggcagtgggctttggaagattttgaaattggtcgtccgctgggt
aaagggaagttcggtaatgtttatttggcgagagaaaaacaaagcaagtttatcctggct
cttaaagtgttatttaaagctcaactagagaaagcaggagttgagcatcagctgagaaga
gaagtagaaatacagtcccaccttaggcatccaaacattctcagactgtatggttatttt
catgatgccaccagagtttacctgattctagagtatgcacctcttggagctgtctataga
gaacttcagaaactgtcaaagtttgacgagcagagaactgctacttatatcacagaattg
gcaaatgcactggcttactgtcactcaaagagagttattcacagagacattaagccggag
aacctgctccttggatcagctggagagcttaagattgccgattttgggtggtcagtgcat
gccccgtcctccaggagaaccaccctctgtggcacgctggactacctcccccccgagatg
atcgaaggccgcatgcatgatgagaaggttgatctctggagccttggcgttctctgctat
gaatttttagttgggaagcctccttttgaggcaagcacataccaagagacctacaaaaga
atatcacgggttgaattcacgttccctgactttgtaccagagggagccagggacctcatt
tcaagactgctgaagcataatcccagccaaaggccgactctaaaagaagtcctggaacac
ccctggatcacagcaaattcatccaaaccatccaatagccaaaaaagcaaagaatcaact
agcaaacaaccttaa

DBGET integrated database retrieval system