KEGG   Equus caballus (horse): 100050161Help
Entry
100050161         CDS       T01058                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100050161 (AURKA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100050161 (AURKA)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100050161 (AURKA)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100050161 (AURKA)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100050161 (AURKA)
   Spindle formation proteins
    100050161 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100050161 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 404 aa AA seqDB search
MDRSKENCISGPVKTTVPLGDGPKRVPVTQQLPQNLLSANSGQAQRVLCPSNSSHRVPSQ
AQKLVSSHKPVQNLKQKQSQATSVPHPVPRPLNNTQRSEQLQPSAPGNNSEKELASKEKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITEL
ANALAYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDLI
SRLLKHNPSQRPTLKEVLEHPWITANSSKPSNSQKSKESTSKQP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacagatctaaagaaaactgcatttcagggcctgttaagactacagttccacttggt
gatggtccaaagcgtgttccggtgactcagcagttacctcagaatctgttatctgcaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcctcccaccgagttccttcgcaa
gcgcagaagcttgtctccagccataaaccagttcagaacctgaagcagaagcaatcgcag
gccaccagtgtccctcaccctgtccccaggccactgaataatacccaaaggagtgagcag
ctgcagccgtcagcccctggaaataattctgaaaaggaactggcatcaaaagagaaaaac
gaagaatcaaaaaaaaggcagtgggctttggaagattttgaaattggtcgtccgctgggt
aaagggaagttcggtaatgtttatttggcgagagaaaaacaaagcaagtttatcctggct
cttaaagtgttatttaaagctcaactagagaaagcaggagttgagcatcagctgagaaga
gaagtagaaatacagtcccaccttaggcatccaaacattctcagactgtatggttatttt
catgatgccaccagagtttacctgattctagagtatgcacctcttggagctgtctataga
gaacttcagaaactgtcaaagtttgacgagcagagaactgctacttatatcacagaattg
gcaaatgcactggcttactgtcactcaaagagagttattcacagagacattaagccggag
aacctgctccttggatcagctggagagcttaagattgccgattttgggtggtcagtgcat
gccccgtcctccaggagaaccaccctctgtggcacgctggactacctcccccccgagatg
atcgaaggccgcatgcatgatgagaaggttgatctctggagccttggcgttctctgctat
gaatttttagttgggaagcctccttttgaggcaagcacataccaagagacctacaaaaga
atatcacgggttgaattcacgttccctgactttgtaccagagggagccagggacctcatt
tcaagactgctgaagcataatcccagccaaaggccgactctaaaagaagtcctggaacac
ccctggatcacagcaaattcatccaaaccatccaatagccaaaaaagcaaagaatcaact
agcaaacaaccttaa

DBGET integrated database retrieval system