KEGG   Equus caballus (horse): 100050161Help
Entry
100050161         CDS       T01058                                 

Gene name
AURKA
Definition
aurora kinase A
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100050161 (AURKA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100050161 (AURKA)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100050161 (AURKA)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100050161 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 404 aa AA seqDB search
MDRSKENCISGPVKTTVPLGDGPKRVPVTQQLPQNLLSANSGQAQRVLCPSNSSHRVPSQ
AQKLVSSHKPVQNLKQKQSQATSVPHPVPRPLNNTQRSEQLQPSAPGNNSEKELASKEKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITEL
ANALAYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDLI
SRLLKHNPSQRPTLKEVLEHPWITANSSKPSNSQKSKESTSKQP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacagatctaaagaaaactgcatttcagggcctgttaagactacagttccacttggt
gatggtccaaagcgtgttccggtgactcagcagttacctcagaatctgttatctgcaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcctcccaccgagttccttcgcaa
gcgcagaagcttgtctccagccataaaccagttcagaacctgaagcagaagcaatcgcag
gccaccagtgtccctcaccctgtccccaggccactgaataatacccaaaggagtgagcag
ctgcagccgtcagcccctggaaataattctgaaaaggaactggcatcaaaagagaaaaac
gaagaatcaaaaaaaaggcagtgggctttggaagattttgaaattggtcgtccgctgggt
aaagggaagttcggtaatgtttatttggcgagagaaaaacaaagcaagtttatcctggct
cttaaagtgttatttaaagctcaactagagaaagcaggagttgagcatcagctgagaaga
gaagtagaaatacagtcccaccttaggcatccaaacattctcagactgtatggttatttt
catgatgccaccagagtttacctgattctagagtatgcacctcttggagctgtctataga
gaacttcagaaactgtcaaagtttgacgagcagagaactgctacttatatcacagaattg
gcaaatgcactggcttactgtcactcaaagagagttattcacagagacattaagccggag
aacctgctccttggatcagctggagagcttaagattgccgattttgggtggtcagtgcat
gccccgtcctccaggagaaccaccctctgtggcacgctggactacctcccccccgagatg
atcgaaggccgcatgcatgatgagaaggttgatctctggagccttggcgttctctgctat
gaatttttagttgggaagcctccttttgaggcaagcacataccaagagacctacaaaaga
atatcacgggttgaattcacgttccctgactttgtaccagagggagccagggacctcatt
tcaagactgctgaagcataatcccagccaaaggccgactctaaaagaagtcctggaacac
ccctggatcacagcaaattcatccaaaccatccaatagccaaaaaagcaaagaatcaact
agcaaacaaccttaa

DBGET integrated database retrieval system