KEGG   Equus caballus (horse): 100050163Help
Entry
100050163         CDS       T01058                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ecb  Equus caballus (horse)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecb00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 248 aa AA seqDB search
MEKGPVRAPAKPRGARCSNGFPEGXPXGPGPSGPAENPPRPNTXEPPNGGRXMYERPCSX
RDNELNLPTWVPAYSXILASLXRTPRQGLLKTPWRISSASRASTQVYKRLISDVLNDAVF
DEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQ
ERLTKQIAVAITEALCPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRE
EFLTLIKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggcccggtgcgggcgcccgccaagccgcggggcgccaggtgcagcaatggg
ttccccgaggggtagccgnncggccccgggccgagcgggccggccgagaacccgccgcgc
ccgaatacannggaaccgcccaacggcggacgctagatgtacgagcggccctgcagctag
agggacaacgagctgaacctgcccacctgggtgcccgcttactcgntcattcttgcctct
ctgtgaaggaccccacggcaggggctactcaagacgccttggagaataagcagtgctagt
cgtgccagcactcaggtttacaagcgtcttatttcagatgtcctaaatgatgctgtattt
gatgaagatcatgacgagatggtaatcgtaaaggacatagatatgttttccatgtgtgaa
catcatctagttccatttgttggaaaggtccatatcggttatcttcctaacaagcaagtc
cttggcctcagcaaacttgcgaggattgtagaaatctacagtagaagattacaagttcaa
gagcgccttacgaaacagattgctgtggcaatcacagaagccttgtgccctgccggagtt
ggggttgtggttgaagccacacacatgtgcatggtaatgcgaggggtacagaaaatgaac
agcaaaactgtgaccagcacaatgttgggtgtgttccgggaagatccgaagacccgggag
gagtttctgaccctcattaaaagctga

DBGET integrated database retrieval system