KEGG   Equus caballus (horse): 100050202Help
Entry
100050202         CDS       T01058                                 

Gene name
RASGRF1
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 1
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100050202 (RASGRF1)
   04010 MAPK signaling pathway
    100050202 (RASGRF1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100050202 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEDPESTEEEAKGSN
QDIEHLDFKIGVEPKDSPSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYRKPISAIPARSLELLFASGQNNKLLYGDPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKAT
LDTSKLYVSSSFSNKIPDESDMTTEKPEDPSALSKQSSEVSVREESDNDQTQSDDGDTET
SPTKSPTTPKSVKSKSSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEG
TPHKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLMDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IVRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccacgtcgcgtccctaggactgctagcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaatctgctcttctacttcgagagcgactccagctcg
aggccctcagggctctacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
cctgcgctctcggccaaggagccactggagaaacagcattatttcacggttaacttcagc
catgagaaccagaaagccttggagctgaggacagaagatgcgaaggattgtgacgagtgg
gtggcagccatcgctcatgccagctacaggaccctggccacagagcatgaagcgctgatg
cagaagtacctgcacctgctgcagatcgtggagacggagaagactgtggccaagcagcta
cggcagcagatcgaggacggggagatcgagatcgagaggctaaaggcggagatcgcatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcacgcccaatgacgaagac
agtgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgc
aagtggaagaccatcatccaggactacatccggtcgccccacgcagacagcatgcgaaag
aggaaccaggtggtgttcagcatgctggaggccgaggccgaatacgtgcagcagctgcac
atccttgtcaacaacttcctgcgcccgctgcgcatggctgccagctccaagaagcctcct
atcactcacgatgatgtcagcagcatcttcctgaacagcgagaccatcatgtttttgcac
cagatcttttaccaaggcctgaaggctcgcatctccagctggcccacactggtcctggcc
gacctgttcgacatcctgctgcccatgctcaacatctaccaggagttcgtccgtaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aaacactacgaggccaagcccgactgcgaggagaggacgctggagactttcctcacctac
cccatgttccagattcccaggtatatcctaacgctgcacgagctcctggcccacacgcct
catgagcatgttgagcgcaacagcctggactatgccaagtccaaactggaagagctgtcc
aggataatgcatgatgaagtaagtgagacagagaacatccggaaaaacctagccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgaggcaa
ggttccctcatccaggtgcccatgtcggaaaagggcaagatcaccagggggcgcctgggg
tctttatccctaaagaaagagggtgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggtggaaaacttcacctgaccaagaatggagtcatatccctc
attgattgcaccttattggaggacccagaaagcacggaggaagaagccaaaggatccaac
caagacatagagcacttggattttaagatcggggtggagccaaaggattccccgtccttc
acagtcatcctcgtggcctcatccagacaggagaaggcagcatggaccagtgacatcagc
cagtgtgtggataatatccggtgcaatgggctcatgatgaacgcgtttgaggagaattcc
aaggtcactgtgccacagatgatcaagtctgatgcctccttatattgtgatgacgtggac
attcgcttcagcaaaaccatgaactcctgcaaagtgcttcagatccggtatgccagtgtg
gagcggctgctggagcggctgacggacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgtgtcttcaccactgccgtcgtggtcctggacaagctcatcacc
atctacaggaagcccatcagcgcaatccccgccaggtcgttggagctcttgtttgccagc
ggccagaacaacaagcttctgtacggtgacccccccaagtccccacgtgccacccgcaag
ttctcctcgccaccacccctgtccatcaccaagacatcatcgcctagccgccggcggaag
ctctccctgaatatccccatcatcacaggcggcaaggccctggacctggctgccctcagc
tgcaattccaatggctataccagcatgtactcagccatgtcgcccttcagcaaggccacg
ctggacaccagcaagctctatgtgtccagcagcttctccaacaagattccagatgagagt
gatatgactacagagaagcccgaagacccctcggctctcagcaagcagagctcagaagtc
tccgtgagggaagagtcagataatgatcaaacccagagtgatgacggtgatactgagaca
tcaccaacaaaatctccaacaacgccaaaatctgtcaaaagcaaaagttcctcagagttc
ccgctcttttcctacaataatggagtcgtcatgacctcctgtcgcgagctagacaataac
cgcagcgccctgtcagcagcctctgcctttgccatagcaaccgcgggtgccaatgagggc
accccacacaaggagaagtaccggaggatgtccttagccagcgcagggtttccccccgac
cagaggaacggagacaaggaatttgtgatccgcagagcggccaccaatcgcgtcctgaac
gtgctccgccactgggtctccaagcactctcaggacttcgagaccaacgatgagctcaaa
tgcaaggtcatcagcttcctggaggaggtcatgcatgacccggagctcctgacccaggag
cggaaggctgcagccaacatcatcaggactctgacccaggaggacccaggtgacaaccag
atcacgctggaggagatcacgcagatggccgaaggcgtgaaggctgagccctttgaaaac
cactcagccctggagattgcagagcagctgaccctgatggaccacctcgtcttcaagaag
attccttatgaggagttctttggacaaggctggatgaaactggaaaagaatgagaggacc
ccttacatcatgaaaaccaccaagcatttcaatgacatcagtaacttgattgcttcagaa
atcgtccgcaatgaggatatcaacgcgagggtgagcgccatcgagaagtgggtggccgtg
gctgacatatgccgctgcttacacaactacaatgctgtgctggagatcacctcatccatg
aaccgaagcgcaatcttccggctgaaaaagacgtggctcaaagtctctaagcagacaaaa
gctttgattgataagctccaaaagcttgtgtcatcagagggcagatttaagaatctgaga
gaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtacctcaccgac
ctggccttcattgaagaggggacacccaattacacggaggacggcctggtcaacttctcc
aagatgagaatgatatcccatattatccgagagattcgccagtttcaacaaactgcctac
aaaatagaacaccaagcaaaggtaacccagtatttactggaccaatcttttgtaatggac
gaagaaagcctctacgagtcttctctccgaatagaaccaaaactccccacctaa

DBGET integrated database retrieval system