KEGG   Equus caballus (horse): 100050308Help
Entry
100050308         CDS       T01058                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100050308 (CYLD)
  Development
   04380 Osteoclast differentiation
    100050308 (CYLD)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100050308 (CYLD)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C67
   100050308 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 953 aa AA seqDB search
MSSGLWSQEKVTSPYWEERSFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKAKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTISGIFFGVELLDEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLEIIEDDDNGLESDYAGPVDTMQVELPPLEINSRVSLKL
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPDSVTQERRPPKLAFTSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNGSSV
DSQPQSKSKNTWYIDEVAEDPAKSLTEISPDFGHASPPLQPPSMNSLSSENRFHSLPFSL
TKMPNTNGSIGHSPLSLSVQSVMGELNNAPVQESPPLAVSSGNSHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHQYNPVSLPKD
LPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggtttatggagccaagaaaaagttacgtcaccctactgggaagagcggagt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacacaaaagctccttaaa
gtacccaaggggagtataggacagtatatccaagatcgttctgtgggacattcgaggatt
ccttctgcaaaagccaagaaaaatcagatcggattaaaaattctagagcagccacatgca
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagatgtgggctgccctgtgaaagtgcagctgagatctggggaagaa
aagtttcctggagttgtgcgcttcagaggacccttattagcagagaggacaatatcggga
atattctttggagtagaattactggacgaaggtcgtggccaaggtttcactgatggggtg
tatcaaggaaagcagctttttcagtgtgatgaagattgtggagtatttgttgcgttggac
aagctggaaatcatagaagatgatgacaatggattggaaagtgactatgcaggtccagtg
gacacaatgcaggttgaactcccccctctggaaataaactccagagtctctttgaagctt
ggagaaactatagaatctggaacagttatattttgtgatgttttgccgggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaaggttt
gatggcgtgcagctttgtagttttgcaagtgttgaaagtacaattctcttgcatatcaat
gatatcatcccagatagcgtgacacaggaaaggaggcctcctaaacttgcctttacatca
agaggtgttggggacaagggttcatccagtcataataaaccaaaggctacaggatctacc
tcagaccctggaaatagaaacagatctgaattgttttataccttaaatgggtcttctgtt
gactcacaaccacaatccaaatcaaaaaatacctggtacattgatgaagttgctgaagac
cctgcaaaatcgcttacagagatatctccagactttggccatgcgtcaccaccactgcag
cctccttccatgaactcgttatccagtgagaacagatttcactctttaccgttcagtctg
acgaagatgcccaacacgaatggaagtattggccacagtccgctgtctctgtcagttcag
tctgtgatgggagagctaaacaatgcacctgtccaggagagtcccccactggccgtgtct
tctgggaactcacatggtctggaagtgggctcactggctgaagttaaagagaaccctcct
ttctatggggtcatccgttggattggtcagccaccaggactcaatgaagtactagctggg
ctggaactggaagacgaatgtgcaggctgtacagacgggaccttccggggcactcggtac
ttcacctgtgccctgaagaaggcgctgttcgttaagctgaagagctgcaggcccgactcc
cgcttcgcgtccctgcagccggtctccaatcagatcgagcgctgtaactcgctagcattt
ggcggctacttaagtgaagtagtagaagaaaatactccaccaaagatggaaaaagagggc
ttagagataatgatcggaaagaagaaaggtatccaggggcattacaattcttgttactta
gactcgaccttattctgcttgtttgcttttagttctgttctggacactgtgttacttaga
cccaaagaaaagaatgatgtagaatattacagtgaaactcaagagctgctgaggacagaa
attgtcaaccctctgagaatatatggatatgtgtgtgcaacaaagattatgaaattgagg
aaaatacttgaaaaagttgaggctgcatcaggatttacctctgaagaaaaagatcctgaa
gaattcttgaatatcctgtttcatcatattttaagggtagaaccattgttaaaaataaga
tcagcaggtcaaaaagtacaagattgttacttctatcaaatttttatggaaaaaaatgag
aaagttggagttcctacaattcagcagttgttagaatggtcttttatcaacagtaacctg
aaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttggaaaagacttt
aaactatttaaaaaaatttttccttctctggaattaaatataacggatttacttgaagat
acccccaggcagtgccgcatctgtggagggctcgccatgtacgagtgtagagagtgctac
gatgatcctgacatctctgctggaaaaatcaagcagttttgtaaaacctgcaacactcaa
gtccaccttcatcccaagagactgaatcaccagtataacccggtgtcacttcccaaagat
ctgcccgactgggactggagacacggctgcatcccctgccagaagatggagttatttgct
gtcctctgcatagaaacgagccactatgttgcgttcgtgaagtacgggaaagacgactct
gcctggctcttcttcgacagcatggccgaccgggatggtgggcagaatggcttcaacatt
cctcaagtgaccccatgcccagaagtaggagagtacttgaaaatgtccctggaagacctg
cactccttggactccagaagaatccaaggctgtgcgcgaagacttctttgtgatgcgtac
atgtgcatgtaccagagtccgacaatgagtttgtacaaataa

DBGET integrated database retrieval system