KEGG   Equus caballus (horse): 100050308Help
Entry
100050308         CDS       T01058                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:ecb04622]
Organismal Systems; Development; Osteoclast differentiation [PATH:ecb04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 953 aa AA seqDB search
MSSGLWSQEKVTSPYWEERSFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKAKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTISGIFFGVELLDEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLEIIEDDDNGLESDYAGPVDTMQVELPPLEINSRVSLKL
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPDSVTQERRPPKLAFTSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNGSSV
DSQPQSKSKNTWYIDEVAEDPAKSLTEISPDFGHASPPLQPPSMNSLSSENRFHSLPFSL
TKMPNTNGSIGHSPLSLSVQSVMGELNNAPVQESPPLAVSSGNSHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHQYNPVSLPKD
LPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggtttatggagccaagaaaaagttacgtcaccctactgggaagagcggagt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacacaaaagctccttaaa
gtacccaaggggagtataggacagtatatccaagatcgttctgtgggacattcgaggatt
ccttctgcaaaagccaagaaaaatcagatcggattaaaaattctagagcagccacatgca
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagatgtgggctgccctgtgaaagtgcagctgagatctggggaagaa
aagtttcctggagttgtgcgcttcagaggacccttattagcagagaggacaatatcggga
atattctttggagtagaattactggacgaaggtcgtggccaaggtttcactgatggggtg
tatcaaggaaagcagctttttcagtgtgatgaagattgtggagtatttgttgcgttggac
aagctggaaatcatagaagatgatgacaatggattggaaagtgactatgcaggtccagtg
gacacaatgcaggttgaactcccccctctggaaataaactccagagtctctttgaagctt
ggagaaactatagaatctggaacagttatattttgtgatgttttgccgggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaaggttt
gatggcgtgcagctttgtagttttgcaagtgttgaaagtacaattctcttgcatatcaat
gatatcatcccagatagcgtgacacaggaaaggaggcctcctaaacttgcctttacatca
agaggtgttggggacaagggttcatccagtcataataaaccaaaggctacaggatctacc
tcagaccctggaaatagaaacagatctgaattgttttataccttaaatgggtcttctgtt
gactcacaaccacaatccaaatcaaaaaatacctggtacattgatgaagttgctgaagac
cctgcaaaatcgcttacagagatatctccagactttggccatgcgtcaccaccactgcag
cctccttccatgaactcgttatccagtgagaacagatttcactctttaccgttcagtctg
acgaagatgcccaacacgaatggaagtattggccacagtccgctgtctctgtcagttcag
tctgtgatgggagagctaaacaatgcacctgtccaggagagtcccccactggccgtgtct
tctgggaactcacatggtctggaagtgggctcactggctgaagttaaagagaaccctcct
ttctatggggtcatccgttggattggtcagccaccaggactcaatgaagtactagctggg
ctggaactggaagacgaatgtgcaggctgtacagacgggaccttccggggcactcggtac
ttcacctgtgccctgaagaaggcgctgttcgttaagctgaagagctgcaggcccgactcc
cgcttcgcgtccctgcagccggtctccaatcagatcgagcgctgtaactcgctagcattt
ggcggctacttaagtgaagtagtagaagaaaatactccaccaaagatggaaaaagagggc
ttagagataatgatcggaaagaagaaaggtatccaggggcattacaattcttgttactta
gactcgaccttattctgcttgtttgcttttagttctgttctggacactgtgttacttaga
cccaaagaaaagaatgatgtagaatattacagtgaaactcaagagctgctgaggacagaa
attgtcaaccctctgagaatatatggatatgtgtgtgcaacaaagattatgaaattgagg
aaaatacttgaaaaagttgaggctgcatcaggatttacctctgaagaaaaagatcctgaa
gaattcttgaatatcctgtttcatcatattttaagggtagaaccattgttaaaaataaga
tcagcaggtcaaaaagtacaagattgttacttctatcaaatttttatggaaaaaaatgag
aaagttggagttcctacaattcagcagttgttagaatggtcttttatcaacagtaacctg
aaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttggaaaagacttt
aaactatttaaaaaaatttttccttctctggaattaaatataacggatttacttgaagat
acccccaggcagtgccgcatctgtggagggctcgccatgtacgagtgtagagagtgctac
gatgatcctgacatctctgctggaaaaatcaagcagttttgtaaaacctgcaacactcaa
gtccaccttcatcccaagagactgaatcaccagtataacccggtgtcacttcccaaagat
ctgcccgactgggactggagacacggctgcatcccctgccagaagatggagttatttgct
gtcctctgcatagaaacgagccactatgttgcgttcgtgaagtacgggaaagacgactct
gcctggctcttcttcgacagcatggccgaccgggatggtgggcagaatggcttcaacatt
cctcaagtgaccccatgcccagaagtaggagagtacttgaaaatgtccctggaagacctg
cactccttggactccagaagaatccaaggctgtgcgcgaagacttctttgtgatgcgtac
atgtgcatgtaccagagtccgacaatgagtttgtacaaataa

DBGET integrated database retrieval system