KEGG   Equus caballus (horse): 100050355Help
Entry
100050355         CDS       T01058                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100050355
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100050355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSPDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcagcgctggctcccgttggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctacatcctaactggcagtttgttgatgtatatggaatggatcctgaa
ctccttagcatggttccacggccagtgtgcgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacagaagaggaggaaaaaataaaatctcagggacaagatgtt
acatcatcagtatatttcatgaagcaaacaatcagcaatgcctgtggaacaattggactg
atccatgctattgccaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggagtctgtgtccatgagccctgaagaacgagccagatacctggagaac
tatgacgctattcgagttactcacgagaccagtgcccatgaaggtcagactgaggccccg
agtccagatgaaaaggtagaccttcatttcattgcgttagttcacgtggatgggcatctc
tatgaattagatggacggaaaccatttccaattaatcacggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaatta
agattcaatgcaattgctctttctgcagcatag

DBGET integrated database retrieval system