KEGG   Equus caballus (horse): 100050355Help
Entry
100050355         CDS       T01058                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSPDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcagcgctggctcccgttggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctacatcctaactggcagtttgttgatgtatatggaatggatcctgaa
ctccttagcatggttccacggccagtgtgcgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacagaagaggaggaaaaaataaaatctcagggacaagatgtt
acatcatcagtatatttcatgaagcaaacaatcagcaatgcctgtggaacaattggactg
atccatgctattgccaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggagtctgtgtccatgagccctgaagaacgagccagatacctggagaac
tatgacgctattcgagttactcacgagaccagtgcccatgaaggtcagactgaggccccg
agtccagatgaaaaggtagaccttcatttcattgcgttagttcacgtggatgggcatctc
tatgaattagatggacggaaaccatttccaattaatcacggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaatta
agattcaatgcaattgctctttctgcagcatag

DBGET integrated database retrieval system