KEGG   Equus caballus (horse): 100050371Help
Entry
100050371         CDS       T01058                                 

Gene name
KAT6A, MYST3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 2012 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRALEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATSVDGKE
SCESLCSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSAELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLERIDGLDFCRDSNVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWDGKQESEERLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDYRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEAEEGDSEEPQCRERGPEASVGKSASRENKEQDSYSSVESEKKPEVMAP
ASSTRLNKQVLPRDTLPANNQPSRRGRWGRKNRKTQERFDDKDSKLLLEETSAPQEQYGE
HEEKSETSQEQYTESEEQLAASQEQPSQDGKPEIPKRRLSEGVELWRGQLKKSPAALKCR
LPEGNDGLPRRYSDGDRALLRGFSESSEEEEEPESPRSTSPPVLTKPTLKRKKPILHRRR
RVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELFS
RGYFRHLSSQDVLRCRSSSKRKSKDEDDDEESDDADDTPILKPVSLLRKCDVKDSPLEPD
TSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNREIIPVSAQECIVEPIVPIPKPGRK
SKIQENEETVEPKEDLPLTEDRKEEMHVEAEEVEEGEEEDTTSSEVRAASPVDSSNSPET
EMKEPEVEEEEEKPRGLEEQRQSEEEQQELEEQEQEEEDEVTVETNRNEDHDADDEDDGH
LESTKIKELEDQPVREDVKEEPGGQESFLDTSMQSSRENIKDKDETEPDSEEEQTSHETS
VVSEHMPGSEDDHEEDSNSKEELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHEGAY
QDCEETLAACQTLQSYTQADEDPQMSMVEDCQASEHNSPISSVQSHPSQSVRSVSSPNVP
ALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENY
ENPSSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQSSCVVTQQMANMGNSCSMIQQNN
VQPATNCNIKSPQSCVVERPPSNQQQPPPPPPQQQQQQQQQQQQQQQQQQQQQQQPAPQP
PPPQQPQQPPPPQPQQPQPPPPPPQQPPLSQCSMNNSFTPAPMIMEIPVFWSTGNISIYE
RDFQGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLA
QLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVK
GHISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVN
SMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNP
HGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggattttggaggccatcaaaaaagtg
aagaaacagaaacagcgtccctcagaggaaaggatatgtaatgcagtgtcttcttcccat
ggcttggatcgcaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggataataaacaaaatgtagattggaat
aaactgatcaagcgggcacttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattatttggaggcagcgctgcc
tctggctttcaccagcagttacggttggctattaaacgtgcgattggccacggccgactc
cttaaagatggacctctttatcggctcaacactaaagcaaccagtgtggatgggaaagaa
agttgtgagtctctttgctctttacctccagtgtcactccttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaacaga
gaaaagaagccagaggaactcatctcttgtgccgactgtggcaacagtggtcatccatcc
tgtttaaagttttccgctgaactaacggttagagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagctcctgtcgagatcaaggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccgaggttttcacatggagtgttgtgatccaccacttacccggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacgaaaactgcta
cagaagaaggcggcacagataaaacggcgctatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtcggaaacgtaaaatcactctctccagccaatcagcatcgtcatcagaagaa
ggatatttagagcgaatagatggcttggacttctgcagagatagcaatgtccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattctttaccccttcccct
gatgggcggaagcctcgaggggaggtggtagactactctgagcaatacagaatcaggaaa
aagggcaacagaaaatcaagcacttcagactggcccacagacaatcaggatggctgggat
ggcaaacaagaaagtgaggaacggctttttgggagccaggaaatcatgactgagaaagat
atggagttgtttcgtgatatccaggaacaagcactgcagaaagttggagtgactggtccc
cctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcacacc
tggtactcttccccatatcctcaagaatactcaaggctgcctaaattgtacctttgcgaa
ttctgtctgaaatatatgaaaagtagaactattctacagcagcacatgaagaaatgtggt
tggttccatcctcctgccaatgagatttacagaaagaataatatttctgtctttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccattccttttttatgtactaacacagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacagaaa
tacaacgtttcctgtataatgattcttccccaataccagcgtaagggctatggcaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagagaaa
ccattatccgatctaggtcgtctttcctacatggcttattggaaaagtgtaatattggag
tgcctttatcaccaaaatgacaagcaaatcagcattaagaagttaagcaagttgactgga
atctgccctcaagacattacgtccacactccaccacctacgtatgctggactaccgtagt
gaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagcttcag
ctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactcccgtcatagtc
tctaattctgtcgtctcagaggaggaggaagaggaggctgaggaaggagacagtgaagag
ccgcagtgccgggaaagaggcccagaggcgagtgtgggaaagtctgcatctcgggagaat
aaagaacaagattcttattcttcagtagaaagtgaaaagaaaccagaagttatggcacca
gctagttctacacgtttgaataaacaagtccttccccgcgatactcttcctgcgaataat
cagccatctcggagaggccgctgggggaggaagaacagaaaaacccaggaacgttttgat
gataaagattctaaactgctcttggaagagacatcagctcctcaggaacaatatggagaa
catgaggaaaaatcggaaacctcccaagaacaatacactgaaagtgaggaacagctggca
gcctctcaggagcagccgagccaggatgggaagccagagatccccaaaagaagactgagt
gagggggttgagctctggcgaggacagctgaagaagagccccgcggccctgaagtgtcgg
ctcccagaaggcaatgacggactgccccgtcgctatagtgatggcgacagggctctcctc
aggggcttcagtgagagcagcgaggaggaagaagagccagaaagtccccgctccacctcc
ccgccagttcttacgaagcccacgttgaagcgaaagaaaccgattcttcaccgaagaagg
agagtccgaaagcgcaaacaccacaatagcagtgtggtcacagaaactatctctgaaact
acagaggtattggatgagccttttgaagactctgactctgagaggccgatgccaaggtta
gaacccacgtttgagattgatgaagaagaagaggaagaggatgaaaatgaactcttctct
agaggatacttccgtcatttgtcctcacaggatgttctcaggtgtcgatcctcttctaag
aggaagtcgaaagatgaagatgatgatgaagagtcagatgatgctgatgatactcctatc
ctaaagccagtatctctcttgagaaaatgtgatgtgaaggattctccacttgagccagat
acatccacgcctatgaaaaagaaaaagggatggcccaaaggcaagagccgcaaaccaatc
cactggaagaaaagacctggtcgcaaaccaggatttaaattgaatcgggaaatcataccc
gtttctgctcaagaatgcattgttgagcccattgtccccattcctaaacctggacgtaaa
tccaaaattcaagagaatgaagaaactgttgaaccaaaagaagacttgcctttaactgaa
gacaggaaagaagagatgcatgtggaagcagaagaggttgaagagggagaagaagaagat
acaaccagcagtgaagttagagcggcttctccagtggatagcagcaatagtcctgagaca
gaaatgaaagaacctgaggtagaggaggaagaagagaaaccccgtggcctagaagaacag
aggcagtcagaggaagagcaacaagaactggaagagcaggagcaggaggaggaggacgaa
gtgactgtggaaacaaaccggaatgaagaccatgatgcagatgatgaagatgacggtcat
ctggagtctacaaagataaaagagctagaggatcagcctgttagagaagacgtcaaggag
gagcctggtggtcaggagtcttttttagatactagtatgcagagcagtagggagaatata
aaggataaagatgaaacagaaccagattctgaagaggagcagacttcccatgaaacatca
gtggtatcggagcatatgccagggtctgaggatgatcatgaagaagattcaaactctaaa
gaagaattaattgagttaaaagaggaagaagagattcctcatagtgaactggatctggaa
accgtgcaagcagtgcaatctttgactcaagaagaaagcaatgagcatgagggagcctac
caggactgtgaagagactctggcagcttgtcagaccctgcagagttatacccaggctgat
gaagaccctcagatgtcaatggttgaagactgccaggcttcagaacataatagtcccata
tcttctgttcagtctcatcctagccagtccgtccgttcagtcagcagtcccaatgtgcct
gcccttgaaagtggttatacccagatcagcccagaacaaggatccctgtccgcaccctct
atgcagaacatggagaccagccccatgatggatgtgccttccgtatcagaccactctcag
caggtggtagacagtggcttcagtgatctgggcagcatcgagagcaccacagaaaactat
gagaaccctagcagttatgattccacgatgggtggcagcatttgtgggaataactcttcc
cagagcagctgctcctatggtgggttgtcatcctccagcagcctcacccagagcagttgt
gttgtcactcagcaaatggcaaacatgggcaacagctgcagcatgatacagcagaacaat
gtccagcctgctaccaactgcaacatcaagtcacctcagagttgtgtggtggagaggcct
cctagtaaccagcagcagccgccgccgccaccaccgcagcagcaacagcagcagcagcag
cagcagcagcagcaacaacaacaacaacaacaacaacaacaacaaccagcaccacagcct
ccaccaccccagcagccgcagcagccaccgccgcctcagccccagcagcctcaaccccca
cccccacccccgcagcagccccccctgtcacagtgtagtatgaataacagtttcactcca
gcgcctatgataatggagataccagtattctggagcactgggaacataagtatctatgag
agggatttccaaggggattttggtgccggcagctactctcaaccgtcagccaccttcagt
ttagccaagttgcagcagctgactaacaccattatggaccctcatgccatgccttatagc
cattctcctgctgtgacttcctatgcaaccagtgtttctctgtctaatacaggactggct
cagctagctccgtctcatccattagcgggaacccctcaagcacaagccaccatgacaccg
cccccaaacttggcatccactaccatgaacctcacgtcacctctgctacagtgcaacatg
tctgccaccaacattggcattcctcacactcagaggttgcaggggcagatgccagtcaag
gggcatatttccatccgctccaaatctgcgccactgccctctgcagctgctcaccagcag
cagctgtatggccgcagcccaccagcggtggccatgcaggctggccctcgtgcgttggcc
gttcagcgtggcatgaacatgggggttaatttaatgccaacccctgcctataatgtcaat
tccatgaatatgaacactttgaatgccatgaacagctatcgaatgacacagcctatgatg
aacagcagttaccatagtaaccctgcttacatgaaccagacagcacagtatcctatgcag
atgcagatggggatgatggggagccaggcctatacccagcagcctatgcagccaaaccct
catggaaacatgatgtacactggcccctcccatcacagctacatgaatgctgctggtgtg
cccaagcagtcactcaatggaccttacatgagaagatga

DBGET integrated database retrieval system