KEGG   Equus caballus (horse): 100050441Help
Entry
100050441         CDS       T01058                                 

Gene name
RAE1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100050441 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100050441 (RAE1)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100050441 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLESQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPIAACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcaggttttggaactagtgggaccagcatgtttggcagc
acaaccacagataatcacaacccaatgaaggatattgaagtgacgtcctctcctgatgat
agcattggttgtctatcttttagcccacccaccttgccggggaactttcttattgcagga
tcgtgggctaatgatgttcgctgctgggaagttcaagacagtggacagactattccaaaa
gcccagcagatgcacacggggcctgtcctggacgtctgctggagtgacgatgggagcaaa
gtatttacagcatcatgtgataaaactgccaaaatgtgggacctcaacagtaatcaggcg
atacagattgcacagcatgatgctcccgttaaaaccatacattggatcaaagcaccgaac
tacagctgtgtgatgactgggagctgggataagaccttgaagttttgggatacacgatcc
tcaaatcctatgatggttttgcaactccccgaaaggtgttactgtgctgacgtgatatat
cctatggccgtggtggcaaccgcggagaggggactgatcgtctaccaattagagagccag
ccttctgagttcaggaggatagagtcgccactgaagcatcagcatcgatgtgtggctatt
tttaaggacaaacagaacaagccaactggttttgctctgggcagcatcgaggggagagtc
gctattcactacatcaaccccccaaaccctgccaaagataacttcaccttcaaatgtcat
cgatcaaatggaaccaatacttcagctcctcaggacatctatgcggtaaatggaatcgca
ttccatcctgttcatggcacccttgcaaccgtgggatctgatggtagattcagcttttgg
gacaaagatgccagaacaaaactaaaaacttcggaacagttggatcagccgatagcagct
tgctgcttcaaccacaatggaaacatatttgcgtatgcttccagctacgactggtcgaag
ggacatgaattttataatccccagaagaaaaattacattttcctgcgtaatgcagctgaa
gagctaaaacccaggaacaagaagtag

DBGET integrated database retrieval system