KEGG   Equus caballus (horse): 100050532Help
Entry
100050532         CDS       T01058                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
ecb  Equus caballus (horse)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100050532 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100050532 (PIK3CG)
   04072 Phospholipase D signaling pathway
    100050532 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    100050532 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    100050532 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100050532 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    100050532 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100050532 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    100050532 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100050532 (PIK3CG)
   05145 Toxoplasmosis
    100050532 (PIK3CG)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100050532 (PIK3CG)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100050532 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
4
AA seq 1102 aa AA seqDB search
MELENYEQPVVLREDNRRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRNSKTPETALLH
VAXHGNVEQMKAQVWLRALETSGAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHVVQRHAPSEDTVAFQQQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDQVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKVRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASADTPSSESKGKVQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLAKREVWDQSALDVGLTMQLLDCSFPDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALVRFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGMAMLHDFTQQVQVIEVLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKRADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLSHWLKERCPLEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaaaactatgaacagcccgtggttctgagagaggacaaccgccgcaggcgc
cggaggatgaagccgcgcagcgccgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccacgagccagcgcaacagcaagacccccgaaacggcgctgctgcac
gtggctnggcacggcaacgtggagcagatgaaggcgcaggtgtggctgcgcgcgctggag
accagcggagcagcggacttctaccaccggctggggccggaccacttcctcctgctctac
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagaccctggac
tgcctgcgctactggaaggtgctgcacaggagcccaggccagatccacgtggtgcaacgg
cacgcgccctcggaggacacggtggccttccagcagcagctcacagccctgattggctat
gacgtcaccgatgtcagcaacgtgcacgacgacgagctcgagttcacacgccgccgcctg
gtcaccccgcgcatggccgaggtggccggccgtgaccccaagctctacgccatgcacccc
tgggtgacgtccaagcccctgccggagtacctgttgaagaagattaccaacaactgcatc
ttcattgtcattcatcgcagcaccaccagccagaccatcaaggtctcggcagatgatacc
ccaggcaccatcctccagagcttcttcaccaagatggccaagaagaagtctctgatggat
atcccggaaagccaaaacgaacaggactttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggtgaaacgcccatcaaaaactttcagtgggtgaggcagtgcctcaagaatggg
gaggagattcacctggtgcttgacactcctccggacccagccctggaccaggtgaggaaa
gaagagtggccactggtggatgactgcacgggagtcaccggctaccatgagcagctgacc
atccacgggaaggaccatgagagcgtgttcaccgtgtccctgtgggactgtgaccggaag
ttcagggttaaagtcagaggcattgatatcccggtcctgccccggaacgctgacctcacg
gtgtttgtggaggcaaacatccagcatgggcagcaagtcctttgccaaaggagaaccagc
cccaaacccttcacggaggaggtgctctggaacgtgtggcttgaattcagcatcaaaatc
aaagacttacccaaaggggctcttctgaacctccagatctactgtggcaaagctccagcg
ctgtctggcaaggcctctgcagacactcccagttctgagtccaaaggcaaagttcagctt
ctctattatgtgaacctgctgctgatagaccaccggttcctcctgcgccacggggaatac
gtgctccacatgtggcagttatccgggaagggcgaagatcaagggagcttcaacgctgac
aagctcacctctgcaaccaacccggacaaggagaactccatgtccatctccattctcctg
gacaattactgtcacccaatagccttgcctaagcatcggcccacccctgatcccgaaggg
gaccgggttcgagccgaaatgcccaaccagcttcggaaacaactggaggcaatcatagcc
actgacccacttaaccctctcacagcagaagacaaagaattgctctggcatttcagatat
gaaagccttaagcatccaaaagcatatcctaagctatttagctcagtgaaatggggacag
caagaaattgtggccaaaacttatcagttgttagccaaaagggaggtatgggatcaaagt
gcattggatgttgggctaacgatgcaactcctggactgcagctttccagatgaaaatgta
agagccattgcggtccagaaactggagagcttggaggacgatgacgttctgcactacctg
ctacagctggtccaggctgtgaagtttgaaccataccatgacagtgcccttgtcagattt
ctgctgaagcgtggcttaagaaacaaaagaattggtcacttcttgttttggttcttgcga
agtgagatagcccagtccaggcactaccagcagaggttcgctgtgatcctggaggcctac
ctgagaggctgtggtatggccatgctgcacgactttacccagcaagtccaagtcatcgag
gtgttacagaaagtcaccattgacattaaatcgctctcagctgaaaagtatgacgtcagt
tctcaagttatatcgcaacttaagcaaaagcttgaaaacctgcagaatttgaatctccct
caaagctttagagttccctatgatcctgggctgaaagcaggagcgctggtgattgaaaaa
tgcaaagtgatggcctccaagaagaagcccctgtggcttgagtttaaacgtgccgaccct
acagctctctcaaatgaaaccattggaattatctttaaacatggagacgatctgcgccaa
gacatgcttattttacagattctaaggatcatggagtctatctgggagactgaatccttg
gatctgtgcctcctgccatatggttgcatttcgactggggacaaaattggaatgatcgag
attgtaaaagatgccacaacaattgccaaaattcagcaaagcacagtgggcaacacggga
gcatttaaggatgaagtcctgagtcactggctcaaagagagatgccctcttgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgctggctactgtgtggcaaccttt
gttctcggaataggcgacaggcacaatgataatattatgatcacagagacgggaaatcta
tttcatattgactttgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gaaagagtgccgtttgtgctaaccccagacttcctgtttgtgatgggaacttctggaaag
aagacaagcctccacttccagaaatttcaggatgtctgtgtgaaggcttatctagccctt
cggcatcacacaaacctactgatcatcctcttctccatgatgctgatgacggggatgccc
cagctaacaagcaaagaagacattgaatatattcgggatgccctaacagtggggaaaaat
gaggaggatgcgaagaagtattttctcgatcagattgaagtttgcagagacaaaggatgg
actgtgcagtttaactggttcctacatcttgttcttggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system