KEGG   Equus caballus (horse): 100050590Help
Entry
100050590         CDS       T01058                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100050590 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100050590 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100050590 (GPX7)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100050590 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 286 aa AA seqDB search
MERGISASTSASRLGCGGQHRGKLVSLEKYRGREWSARADFGAPWPGLMGAPAVPGPAGY
GSEGARAARQPCTGAPLLPSLSIPPRRGAPRSCAGLARDYVAQPPRSVKPETLAAGADFP
PSDFGLRGRTSPRGWMPRPSLCHAWVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNV
LAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVVGTGAHPAFKYLTQTSGKEPT
WNFWKYLVAPDGKVVGAWDPTVSVEEIRPHITELVRKLILKKREDL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggggatttcagctagcacctctgcctctcggctaggctgtggcggtcaacat
cggggcaagctggtgtcgctggagaagtaccgcggtcgtgagtggtccgcccgcgcggac
ttcggcgcgccctggccgggcctgatgggggcgcccgcggtcccgggacctgccgggtat
ggctccgagggggctcgggccgcccggcaaccctgcactggcgcccccctcctcccgtcc
ctcagcatccccccgcggcgcggcgcccccaggtcttgcgccggtctggcccgcgactac
gtggcacagcccccgcgctcagtgaaacccgaaactctcgcagccggcgccgatttccct
cccagcgactttgggctgcggggtcggacctctcccaggggctggatgccccggcccagc
ctttgtcatgcatgggtctccctggtggtgaacgtggctagcgagtgcggcttcacagac
cagcactaccgagccctgcagcagctgcaacgggacctggggccccaccacttcaacgtg
cttgccttcccctgcaaccagtttggccagcaggagcctgacagcaacaaggagatcgag
agctttgcccgccgcacctatagcgtctctttccccatgtttagcaagatcgcagtcgtc
ggcactggagcccaccctgccttcaagtacctgacccagacttctgggaaggagcccacc
tggaacttctggaagtacctagtggccccagatgggaaggttgtaggggcttgggatcca
accgtgtcggtggaggagatcagaccccatatcacagaacttgtgaggaagctcatcctg
aagaagcgagaagacttgtaa

DBGET integrated database retrieval system