KEGG   Equus caballus (horse): 100050695Help
Entry
100050695         CDS       T01058                                 

Gene name
AGL
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase (EC:2.4.1.25 3.2.1.33)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ecb  Equus caballus (horse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecb00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1533 aa AA seqDB search
MGHSKQIRTLLLNEMEKLEKTLFRLEQGFELQFRLGPTLQGKAVTVYTNYPFPGETFNRE
KFHSLQWENPTEREDDSDKYCKLNLQQAGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLTKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSSYSLADQLE
LNPDFSRPNKKYTWHDVGQLVEKLKKEWDILCITDVVYNHTAANSKWIHEHPESAYNLVN
SPHLKPAWVLDRALWHLSCDVAEGKYREKGVPALIENDHQMNCIRKIIWEDIYPKIHLWE
FFQVDVHKAVEQFRGLLTQENRKIISQPDPKQHLKIIQDPEYRRLGCTVDMNIALATFIP
HDNGPAAIDECCNWFRKRIEELNAEKHQLVNYHQEQAVNCLLGNVFYERLAGHGPKLGPV
TRKHPLVTRYFTFPFEEMTPSTEESMIHLPNKACFLMAHNGWVMGDDPLRNFAEPGSDVY
LRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATHFQGVRLDNCHSTPIHVAEYM
LDAARKLQPNLYVVAELFTGSEDLDNIFVTRLGISSLIREAMSAADSHEEGRLVYRYGGE
PVGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSSTIVSMASCASGSTKG
YDELVPHQISVVSEERFYTKWNPEALPSNTGEVNFQSGIIAARRAINKLHQELGAKGFIQ
VYVDQVDQDIVAVTRHSPSIHQSVVSVSRTAFRNPKTSFYSKEVPHMYIPGKIEEVVLEA
RTIERHTIPYKKDENSINGMPDITVEIREHIQLNESKIVKHAGIVTKGPNEFVQEIEFEN
LTPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILKIPFASIASKL
TLAELNQVLYRCESEEQEDGGGCYNIPNWSSLKYAGLQGLMSILAEIRPRNDLGHPFCDN
LRSGDWMIDYVSSRLISRSGTIAEVGKWLQAMFLYLKQIPRYLIPCYFDAILIGAYTTLL
DIAWKQMSSFVQNGSTFVKHLSLGSVQMCGVGKFPSLPLLSPSLTDLPYRVNEITKEKEQ
CCGSLAAGLPHFSAGIFRCWGRDTFIALRGLLLVTGRYLEARNIILAFAGTLRHGLIPNL
LGEGTHARYNCRDAVWWWLQCIQDYCKIVPNGLDILRCPVSRMYPTDDSVPLSAGTVDQP
LFEVIQEAMQRHVQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVYGGNRFNCGTW
MDKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVRWLLELSRKNIFPYHEVRVKRHGKF
VTVSYDEWNRKIQDNFEKLFHVSEDPSDFNEKHPELVHKRGIYKDSYGASSPWCDYQLRP
NFTIAMVVAPELFTPEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGIYDNALDNDNYNL
AKGFNYHQGPEWLWPTGYFLRAKLYFSKLMGPETNAKTMFLVKNVLSRHYVHLERSPWKG
LPELTNENGQYCPFSCETQAWSIATVLETLYDL
NT seq 4602 nt NT seq  +upstreamnt  +downstreamnt
atgggacacagtaaacagattagaactttacttctgaacgaaatggaaaagctggaaaag
accctcttcagacttgagcaagggtttgaactacagttccgattaggcccaactttacag
ggaaaagcagttactgtgtatacaaattacccatttcctggagaaacatttaatcgagag
aagttccattccttgcaatgggaaaatccaacagaaagagaagatgattctgataaatac
tgtaaacttaatcttcaacaagctggatcatttcagtattacttccttcaaggaaatgag
aaaagtggtgggggttacatagttgtggatcctattttacgtgttggtgctgataatcat
gtgttacccttggactgtgttactctccagacttttttaactaagtgtttgggacccttt
gatgaatgggaaagcagacttagggttgcaaaagaatcaggttacaacatgattcatttt
acaccattgcagactcttggactatctaggtcatcctactcccttgctgaccagttagaa
ttaaatcctgacttttcaagacctaataaaaagtatacctggcatgatgttggacagcta
gtggaaaaattgaaaaaggaatgggatattctttgtattactgatgttgtctacaatcat
actgctgctaatagtaaatggatccatgaacatccagaaagtgcatataaccttgtgaat
tctccacacttaaaacctgcctgggtcttagacagagcactttggcatttatcctgtgat
gtggcagaagggaaatacagagaaaaaggagtacctgctctgattgaaaatgatcatcaa
atgaattgcattcgaaaaataatttgggaggatatttatccaaagattcacctctgggaa
tttttccaagtagacgttcacaaagcagttgagcaatttagaggacttcttacacaagaa
aataggaaaataatatctcagcctgatccaaagcaacaccttaagattattcaggatcct
gaatacagacggcttggctgtactgtagatatgaacattgcactagcaactttcatacca
catgataatgggccagctgcaattgatgaatgctgtaattggttccgtaagagaattgag
gaattaaacgcagagaagcatcaacttgtgaactatcatcaggagcaggcagttaattgc
cttttgggaaatgtattttatgaacgactggctggccatggtcctaaactaggacctgtc
accagaaaacatcctttagttaccagatattttactttcccatttgaagaaatgacccca
tccacagaagaatctatgattcatctcccaaataaagcttgttttctgatggcgcataat
ggatgggtaatgggagatgatccccttcggaactttgctgaaccaggttcagacgtttat
ctaaggagagaacttatctgctggggagacagtgttaaattacgctatgggaataagcca
gaggactgtccttacctctgggcgcacatgaaaaaatacactgaaataactgcaactcat
ttccagggagtacgtcttgataactgccactcaacaccaattcatgtagccgagtacatg
ttggatgccgctaggaaattgcaacccaatttatatgtagtagctgaactgttcacagga
agcgaagacctggacaatatctttgttactagactgggcattagttccttaataagagag
gcaatgagtgcagctgatagccatgaggagggcagattagtttaccgatatggaggagag
cctgttgggtcctttgttcagccctgtttgaggcctttaatgccagctattgcacatgcc
ctgtttatggatatcacccatgataatgagtgtcctattgtgcataggtcagcatatgat
gctctcccgagttccacgattgtttctatggcatcttgtgctagtggaagtactaaaggc
tatgatgaattagtgcctcatcagatttcagtggtttctgaagaacgattttatactaag
tggaatcctgaagcattgccatcaaatacaggtgaagtcaatttccaaagcggaattatt
gcagccaggcgtgctatcaataaacttcatcaagagcttggggccaagggtttcattcag
gtgtatgtggatcaggttgatcaagatatagtggcggtaacaaggcactcacctagcatc
catcagtctgttgtgtctgtgtcgagaactgctttcaggaatcccaagacgtcattttac
agcaaggaagtgcctcatatgtacatccctggcaaaattgaagaagtagttcttgaagct
agaactattgagagacatacaataccttataagaaggatgaaaactcaatcaatggaatg
ccagatatcacagtagaaattagagaacatattcagcttaatgaaagtaaaattgttaaa
catgctggaattgtcacaaaaggacccaatgaatttgttcaagaaatagagtttgaaaac
ttgactccaggaagtgttattatattcagagttagtcttgatccacatgcacaagttgct
gttggaattcttcgaaatcatctgacacaattcagtcctcactttaaatctgggagcctt
gctgttgacaacgcagatcctatattgaaaattccttttgcttctattgcctctaaatta
actttggctgagctaaatcaggtcctttatcgatgtgaatcagaagaacaagaagatggt
ggagggtgttataacataccaaactggtcgtctcttaaatatgcaggtcttcaaggatta
atgtccatattggcagaaataagaccaaggaatgacttggggcatcccttttgtgacaat
ttgagatctggagattggatgattgactatgtcagtagccggcttatttcacgatcagga
actattgctgaagttggtaaatggttgcaggctatgttcctctacctgaagcagatcccc
cgttatcttattccatgttactttgatgctatattaattggtgcatacaccactctcctg
gatatagcatggaagcagatgtcaagctttgttcagaatggttctacctttgtgaaacac
ctttctctgggttcagtccaaatgtgtggagtaggaaaattcccttctctgccacttctt
tcaccttcccttacggatctaccatatagagtaaatgagatcacaaaagaaaaggagcag
tgttgtgggtctctagctgcaggcttacctcatttttctgctggcattttccgctgctgg
ggaagggataccttcattgcgctcagaggtctgctgctggttacgggacgctatttggag
gccaggaatattattttagcatttgctggcaccctgagacacggtctcattcctaatctc
ctgggtgaaggaactcacgccagatacaattgccgggatgctgtgtggtggtggctacag
tgtattcaggattactgtaaaattgttccaaatggcctggacatcctcaggtgcccggtt
tccagaatgtatcctacagatgattctgttcctttgtctgctggcacagtggatcaacca
ttgtttgaagtaatacaggaagctatgcaaagacatgtgcagggcatacagttccgagaa
aggaatgctggtccacagatagatcgaaacatgaaggatgaaggttttaatataactgca
ggagttgatgaagaaacgggatttgtttatggaggaaatcgcttcaattgcggcacatgg
atggataaaatgggagaaagtgacagagctagaaacagaggaatcccggccactccaaga
gatgggtctgctgtggaaattgtgggcctgagtaaatctgccgttcgttggttgctggaa
ttatcccgaaaaaatattttcccttatcatgaagtccgagtaaaaagacatggaaagttt
gtgacagtctcatatgatgagtggaacagaaaaatacaagacaactttgaaaagctattt
catgtgtcagaagacccttcagattttaacgaaaagcatcctgagctggttcacaaacgt
ggcatatacaaagatagttatggagcatcaagcccttggtgtgactaccagctcaggcct
aattttaccatagcaatggtcgtagcccctgagctgtttaccccagaaaaagcatggaaa
gctttggagattgcagaaaaaaaattgcttggtccccttggcatgaaaactttggatcca
gatgatatggtttactgtggaatttatgacaatgccttagacaatgacaactacaatctt
gctaaaggtttcaattatcaccaaggacctgagtggctgtggcccactggatattttctt
cgtgcaaaattgtatttttccaaattaatgggtccagagactaatgcaaagactatgttt
ttggttaaaaacgtcctttccagacattatgttcatcttgagagatccccttggaaagga
cttccagaactgactaatgagaatggccaatactgtcctttcagctgtgaaacacaagcc
tggtcaattgctactgttcttgaaacactctatgacttatag

DBGET integrated database retrieval system