KEGG   Equus caballus (horse): 100050764Help
Entry
100050764         CDS       T01058                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:ecb00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 565 aa AA seqDB search
MWLFALVLVSLATSTVWGHPSSPPVVDTAQGKVLGKHVSLEGFAQPVAVFLGVPFAKPPL
GSLRFAPPQPADPWPFVKNATSYPPMCSQDPVAGQIASDLFTIRKENIPVQFSEDCLYLN
IYTPADLTKKSRLPVMVWIHGGGLMVGGASTYDGLALSAHENVVVVTIQYRLGIWGFLST
GDEHSPGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVAFTAGLVQKDSKAAAQQIAVFAGCKSTTSAVIVHCLRQKTDDELLELSLKM
KFLSLDLLGEPRESHPLLPTVVDGVLLPKMPEEILAEKTFNTVPYIVGINKQEFGWIIPT
MMGYPLSEGKMDQRTATSLLQNSSTLLNIPEELTPVAIEKYLGGTDDPVKKKDLFLDLMG
DVMFGVPSVTVARLHRDAGASTFMYEFQYRPSFSSAMRPKTVIGDHGDEIFSVFGAPFLK
EGASEEEIKLSKMVMKFWANFARTGSPNGEGLPHWPVYDQKEGYLQIGVTTQAAQKLKDK
EVAFWTELLAKKAAEKQQQTEHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttcgctctggtcctggtctccttggccacctccacagtttgggggcaccca
tcctcgccgcctgtggtggacaccgcgcagggcaaggtcctggggaagcatgtcagcctg
gaaggatttgcacagcccgtggccgttttcctgggggtcccttttgccaagccccccctg
ggatccctgaggtttgctccgccgcagcctgcagatccatggcccttcgtgaagaacgcc
acctcctaccctcccatgtgctcccaggacccagtggcagggcagatagcctcggacctc
tttaccataagaaaggagaacattcctgtccagttttctgaagactgtctttacctaaat
atttacactcccgctgacttgacaaaaaaaagcaggctgccggtgatggtgtggatccat
ggaggtggtctgatggtaggtggagcatcaacctatgatgggctggccctctctgcccat
gaaaacgtggtggtggtgaccattcagtaccgcctcggcatctggggattcctcagcaca
ggggacgagcacagccccggaaactggggtcacttggaccaggtggctgcattgcactgg
gtccaggataacatcgccaactttggaggggacccaggctccgtgacgatctttggagag
tcagcaggaggtgaaagtgtctctgttcttgtgttatctccactggccaagaacctcttc
caccgggccatctctgagagtggtgtggccttcactgctggcctggtccagaaggactcg
aaggccgcagctcagcaaattgctgtgtttgctgggtgcaaaagcacgacctcggctgtc
attgttcactgcctacgccagaagacagacgacgagctcttggagttgtcgctgaagatg
aaatttctcagtcttgacttacttggagaacccagagagagccatcccttgctgcccact
gtggttgatggagtgctgctgccaaagatgcctgaggagattctggctgaaaagacgttc
aacactgttccctacattgtcggaatcaacaagcaggagtttggctggattattccaacg
atgatgggctacccgctctctgaaggcaagatggaccagaggacagccacgtcactcttg
cagaactcctccaccctccttaacatccctgaggaactgactccagtggccattgagaag
tatttaggagggacagacgaccctgtcaaaaagaaagacctgttcctggacttgatgggg
gatgtgatgtttggtgtcccatctgtgactgtggcccggctccacagagatgccggagcc
tccaccttcatgtatgagtttcagtaccgcccaagcttttcatcagccatgagacccaag
acggtgataggggaccatggagatgagatcttctctgtcttcggggccccatttctaaaa
gagggtgcctcagaagaggagatcaaactcagcaagatggtgatgaaattctgggccaac
tttgctcggactgggagccccaatggtgaggggctgccccactggccagtgtacgaccag
aaggaagggtacttgcagattggtgtcaccactcaggcagcccagaagctgaaagataag
gaagtggctttctggaccgagctcctggccaagaaggcagcagagaagcaacaacagaca
gaacatgttgaactttga

DBGET integrated database retrieval system