KEGG   Equus caballus (horse): 100051005Help
Entry
100051005         CDS       T01058                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X2
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04218  Cellular senescence
ecb04530  Tight junction
ecb04660  T cell receptor signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing's syndrome
ecb05161  Hepatitis B
ecb05162  Measles
ecb05165  Human papillomavirus infection
ecb05166  HTLV-I infection
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05212  Pancreatic cancer
ecb05214  Glioma
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
Module
ecb_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100051005 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100051005 (CDK4)
   04115 p53 signaling pathway
    100051005 (CDK4)
   04218 Cellular senescence
    100051005 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    100051005 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100051005 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051005 (CDK4)
   05203 Viral carcinogenesis
    100051005 (CDK4)
   05212 Pancreatic cancer
    100051005 (CDK4)
   05225 Hepatocellular carcinoma
    100051005 (CDK4)
   05214 Glioma
    100051005 (CDK4)
   05220 Chronic myeloid leukemia
    100051005 (CDK4)
   05218 Melanoma
    100051005 (CDK4)
   05219 Bladder cancer
    100051005 (CDK4)
   05224 Breast cancer
    100051005 (CDK4)
   05222 Small cell lung cancer
    100051005 (CDK4)
   05223 Non-small cell lung cancer
    100051005 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051005 (CDK4)
   04934 Cushing's syndrome
    100051005 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    100051005 (CDK4)
   05162 Measles
    100051005 (CDK4)
   05161 Hepatitis B
    100051005 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100051005 (CDK4)
   05165 Human papillomavirus infection
    100051005 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    100051005 (CDK4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100051005 (CDK4)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100051005 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100051005
NCBI-ProteinID: XP_005611409
Ensembl: ENSECAG00000025015
UniProt: F6QM47
Position
6
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKPEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacccctcggtatgagccagtggctgagattggtgtcggcgcctatgggacggtg
tacaaggcccgtgatccccacagtggccactttgtggcccttaagagcgtgagagtcccc
aatggaggaggcgctggagggggccttcccatcagcacagttcgtgaggtggccttgctg
aggcggctggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccact
gcccgaactgaccgggagaccaaagtgaccctggtatttgagcatgtggaccaagaccta
aggacgtatctcgacaaggcacccccgcccggcttgccagtggagaccatcaaggatctg
atgcgccagttcctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcaatctacgtatgcaacacctgtggacatgtggagtgtg
ggctgtattttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctacccccagaggaagactggccgcga
gatgtgtctctaccccgaggagcctttccccccagagggccccgccccgtgcagtcggtg
gtgcccgagatggaggagtctggagcacagctgcttctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaagccggaaggt
aacccagagtga

DBGET integrated database retrieval system