KEGG   Equus caballus (horse): 100051005Help
Entry
100051005         CDS       T01058                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ecb  Equus caballus (horse)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ecb04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:ecb04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:ecb04115]
Cellular Processes; Cell communication; Tight junction [PATH:ecb04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ecb04660]
Human Diseases; Cancers; Pathways in cancer [PATH:ecb05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:ecb05212]
Human Diseases; Cancers; Glioma [PATH:ecb05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:ecb05220]
Human Diseases; Cancers; Melanoma [PATH:ecb05218]
Human Diseases; Cancers; Bladder cancer [PATH:ecb05219]
Human Diseases; Cancers; Small cell lung cancer [PATH:ecb05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:ecb05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ecb05166]
Human Diseases; Infectious diseases; Measles [PATH:ecb05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:ecb05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKPEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacccctcggtatgagccagtggctgagattggtgtcggcgcctatgggacggtg
tacaaggcccgtgatccccacagtggccactttgtggcccttaagagcgtgagagtcccc
aatggaggaggcgctggagggggccttcccatcagcacagttcgtgaggtggccttgctg
aggcggctggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccact
gcccgaactgaccgggagaccaaagtgaccctggtatttgagcatgtggaccaagaccta
aggacgtatctggacaaggcacccccgcccggcttgccagtggagaccatcaaggatctg
atgcgccagttcctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcaatctacgtatgcaacacctgtggacatgtggagtgtg
ggctgtattttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctacccccagaggaagactggccgcga
gatgtgtctctaccccgaggagcctttccccccagagggccccgccccgtgcagtcggtg
gtgcccgagatggaggagtctggagcacagctgcttctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaagccggaaggt
aacccagagtga

DBGET integrated database retrieval system