KEGG   Equus caballus (horse): 100051016Help
Entry
100051016         CDS       T01058                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ecb  Equus caballus (horse)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ecb00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ecb03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 530 aa AA seqDB search
MAATKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVENLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGANGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKVLPNVRSSSEIY
GLMKISHSLKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCV
FSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIQTSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSSESGIP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacgaagaaagcagttttggggccgctggtgggggcggtggaccagggcacc
agctcgacgcgctttttggttttcaattcgaaaacagccgaactacttagtcatcatcaa
gtggaaataaaacaagagtttccaagagaagggtgggtggaacaagaccctaaggaaatt
ctgcagtctgtctacgagtgtatagagaaaacctgtgagaagcttggacagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaagttaactggagagccgctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgagaatcttagtaaaagaattccaggaaataataactttgtcaagtccaag
acaggccttccgcttagcacttacttcagtgcggtgaaacttcgttggctccttgacaat
gtgagaaaagttcaaaaggctgttgaagaagatagagctctttttgggactattgattca
tggcttatttggagtttgacaggaggagccaatggaggcgtccattgtaccgatgtaaca
aatgcaagtaggacgatgcttttcaacattcattctctggaatgggataaagagctctgc
gaattttttgaaattccaatgaaagtccttccaaatgtccggagttcctctgagatctat
ggcctaatgaaaatctctcatagcctgaaagctggggccttggaaggtgtgccaatatct
gggtgtttgggagaccagtctgctgcattggtgggacaaatgtgcttccaggatggacaa
gccaaaaacacgtatggaacaggctgtttcttactatgtaatacaggccgtaagtgtgta
ttttctgaacacggccttctgaccacagtggcttataaactcggcagagataaacccgta
tattatgcattggaaggttctgtagctatagctggtgctgttattcgctggctaagagac
aatctaggaattatacagacctcagaggaaattgaaaaacttgctaaagaagttggtact
tcttatggctgctatttcgtcccagcattttcagggttatatgcgccttattgggagccc
agtgcaagagggatcatctgtgggctcacacagttcaccaataaatgccatattgctttt
gccgcattagaagctgtctgtttccaaacccgagagattttggatgccatgaaccgcgac
tgtgggattccactcagtcatttgcaggtagatggaggaatgaccaacaacaagattctt
atgcagctccaagctgacattctgtacatcccagtagtgaagccctcgatgcctgaaaca
acggctctgggagctgccatggctgcaggcgctgcagaaggcgtcggcgtctggagtctc
gaacccgaggatttgtcagctgtcacaatggaacggtttgaaccccagatcaatgctgag
gaaagtgaaattcgttattctacgtggaagaaagctgtgatgaagtcaatgggttgggtt
acaactcagtcttcggaaagtggtatcccgtaa

DBGET integrated database retrieval system