KEGG   Equus caballus (horse): 100051066Help
Entry
100051066         CDS       T01058                                 

Gene name
ART3
Definition
(RefSeq) ADP-ribosyltransferase 3
  KO
K00775  
ADP-ribosyltransferase 3 [EC:2.4.2.31]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100051066 (ART3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecb00537]
 Enzymes
  100051066 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 395 aa AA seqDB search
MKTGHFEMVSMVLAAMILVDIFQVKAEILDMADNAFDDEYLTCTDRMEIKYVPQLLQEEK
ASHQLLADVWENAKAKWEVQKTQIFLPKSFKDDHGIALMAYIFEAQEQTHFYHLFSEAVK
MAGQSRKDYIYGFQFKAFHFYLTKALQLLRRPCEDSYKTVVYIRSQGTSFTFGDTNQARF
GLFTLAYSAKPQTTDDQHILLTIHTCFGVAVEKFFDKESERIILIPLNEVFHVSQDGAGN
NLILQSTNKTCSHYECAFLGGLKTANCVENVEYLQPIYVYNPDEKNQVLEDPGMESQEST
VLPGMRSHEPTQIPGMKIQEPFSLPGVKVVQPDEKPEDKSEEDIDNPTPGPGPVPVPGPG
PKTHPSASSGKMLLPPFGTFIILISASAVNLFVAL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaggacattttgaaatggtcagcatggtgctagcagctatgattctagtggac
atcttccaggtgaaagctgaaatattagacatggcagataatgcgtttgatgatgaatac
ctgacatgtactgacaggatggaaatcaaatatgttccccaactgctccaggaggaaaaa
gcaagccatcagctcttggcggatgtgtgggaaaatgcaaaagccaaatgggaagtccag
aagactcagatctttctccctaaaagttttaaggatgaccatggaatagctctgatggca
tatatttttgaagctcaagagcaaactcacttttaccatctgttcagtgaagctgtaaag
atggctggtcagtctcgaaaagattatatctatggcttccagttcaaagcttttcatttt
tacctgacaaaagccctgcagttgctgagaagaccttgtgaggacagttacaaaactgtg
gtgtatatcagaagccagggtacttcatttacatttggagacacaaatcaagccagattt
ggccttttcaccttggcgtattcagccaaacctcaaactactgatgaccagcacattttg
ttaaccattcacacatgctttggagttgctgttgaaaagttcttcgataaagaaagtgaa
agaattatcttaatacctctgaatgaggtttttcatgtgtcacaggatggggctggcaat
aaccttatccttcaaagcacaaacaagacctgcagccattacgagtgtgcgtttctaggt
ggactgaaaactgcaaattgtgttgagaacgtggaatatcttcaacccatctatgtctac
aaccctgatgagaaaaatcaggtgcttgaagaccctggaatggaaagccaggagtccact
gtcttacctggaatgaggagccatgaacccactcaaatccctggaatgaaaattcaagaa
cctttttcactacctggagtaaaagtggtacaaccggacgaaaaacctgaagacaaaagt
gaagaagatatcgacaatcctacaccaggtccaggtccagttccagttccaggtccaggt
cccaaaactcatccttctgcatcctctggcaaaatgctccttccaccatttgggacattc
atcattttaatcagtgcttctgctgtaaatctctttgttgctctgtag

DBGET integrated database retrieval system