KEGG   Equus caballus (horse): 100051090Help
Entry
100051090         CDS       T01058                                 

Gene name
WHSC1
Definition
(RefSeq) Wolf-Hirschhorn syndrome candidate 1
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100051090 (WHSC1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100051090 (WHSC1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100051090 (WHSC1)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100051090 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1391 aa AA seqDB search
MEFSIKKNPLSVQKVVKCIKMKQAPEILGNTNGKTQNCEVNRECSVFLSKAQLSTSLQEG
VMQKFNGHDALPFIPTEKLKDLTSRVFNGEPGAHDARLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAATVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISGPSDKKIPAKKESCPSTGKDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVTFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLRLNPHVA
KEAGIAVESLGEMVESSGVTEEAAYNSKPMREEGIPIKRRRRAKLPSSAENQESDPGTVK
TTPQKTAEGDSKRGVGSPSGRKKATASTPRSRKGDAASQFLVFCQKHRDEVVAEHPDASS
EEIEELLGSQWNMLNEKQKARYNTKFALVASSQSEEDSGSSLKSFGEAKRKVFQDSPKRR
PRPRSNLNGKKRNHTKRTQDPTEDVEVEDAPRKRLRTDKQGLRKREMITDKTARTSSCKA
IEAASSLKSQAATKHLSDACKPLKKRNRASAAASSALAFSKSSSPSASLTENEVSDGQGD
EPLESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKTGSLVLCEGPCCGAFHLAC
LGLSRRPEGRFTCSECASGIHTCFVCKENKTDVKRCVVSQCGKFYHEACVRKYPLTVFES
RGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICT
GHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRA
GKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQA
RVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQENERKPPPYKHI
KVNKPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEYCQN
QCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDI
THFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTE
LTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTSLSSEEKGKKTKKKTRRRRTKGEG
KKKSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTS
FCHFCPNSFCKEHQDGTAFSSTQDGRSYCCEHDLGAESVRSAKTEKPFPEPMKSKGKRKK
RRCWRRVTEGK
NT seq 4176 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaaaaaaaatcctctttctgttcagaaagttgtaaagtgcataaag
atgaagcaggcaccagaaatccttggcaatacaaatggaaagacacagaactgtgaagtg
aatcgcgaatgttctgtattcctcagcaaagcccaactttctaccagtctacaggagggg
gtcatgcagaaatttaatggtcacgatgcacttccttttattccaactgagaagctgaaa
gatctaacttctcgtgtgtttaatggagaacccggtgctcatgatgccagattgcgtttt
gagtcccaggaaatgaaaggaattgggacaccacctaacactacccctatcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacatacatgaatgggaaacctctctttgaa
tcttccatttgtggtgatggtgctgctactgtgtcccagtcagaagaaaatggacaaaaa
ccagaaaataaggcaagaaggaacaggaagagaagcataaaatatgactccttgctggag
cagggccttgtggaagcagctctggtgtccaagatctcgggtccctcagataaaaagatt
ccagctaagaaagagtcctgtccaagtaccggcaaagacaaagaccacctgttgaaatat
aatgttggtgatttggtgtggtccaaagtgtccggttacccttggtggccatgcatggtt
tctgccgatccactccttcacagctataccaaacttaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgtaacttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctgttgaagcctatttcagggaaattgagggcc
cagtgggaaatgggcatcgttcaagcggaagaagctgcaagcatgtccgtagaggagcgg
aaagccaagttcaccttcctctacgtgggggaccagcttcgtctcaaccctcacgtagct
aaggaggcaggcattgctgtggagtctctgggagaaatggtggaatcctcaggagtcact
gaagaagctgcttataactccaagcccatgagagaagagggcattcctatcaagagaagg
cggagagccaagctgcctagctctgctgaaaaccaagaaagtgaccctgggacagtaaag
actactcctcaaaagacagcagagggtgactctaagaggggagtaggatctccttctggg
aggaagaaggccacagcctccactccgcggagcaggaagggagatgcggcatcccagttt
ttggtcttctgtcaaaagcacagggatgaggttgttgctgagcacccagatgcctccagt
gaggagattgaagagttgcttggatcccagtggaacatgctcaatgagaaacagaaagcg
cgctataacacaaagtttgccctagtggcctcttcccagtctgaagaagactctggttca
tcattgaagagttttggagaggccaaacgtaaagtgtttcaagactcacctaaaaggaga
ccgagacccagaagtaacttaaatgggaaaaaaagaaaccacacaaagaggacacaggac
ccaacagaggacgttgaagttgaggatgcacccaggaaaagactcaggaccgacaagcag
ggtcttcggaagagagagatgatcactgacaaaacagcccgaacaagctcttgcaaggcc
atagaggcagcctcctcgctgaagagccaggcagcaacgaaacatctgtctgacgcatgc
aaaccactgaagaaacgaaatcgggcttctgcagcagcgtcttcagctcttgcgtttagc
aaaagttcatctccttctgcatccttaactgagaatgaggtatcagatggccagggagac
gagcccttggagtccccatatgaaagtgcagacgaaacgcaaactgaagtgtccgtctcg
tctaaaaagtctgaaagaggagtaactgccaagaaggagtacgtgtgtcagctgtgtgag
aagaccggcagcctcgtgctctgcgaaggcccctgttgcggagctttccaccttgcttgc
cttgggctttcccggagaccagaagggaggttcacctgcagcgagtgtgcttcagggatt
cacacgtgtttcgtgtgtaaggagaacaagacagatgttaagcgctgtgtcgtatctcag
tgtggaaaattttaccatgaagcttgtgtgagaaaataccctctgactgtgtttgaaagt
cgaggctttcgctgccctctccacagctgtgtgagctgccatgcttcgaacccttcaaac
ccaagaccgtcgaaaggtaaaatgatgcgctgtgttcgctgccccgttgcctatcatgga
ggggacgcttgtctggcagcaggctgctcggtgatcgcttccaacagcataatctgcacg
ggccacttcactgctcggaaggggaaaaggcatcatgctcacgtcaatgtgagctggtgc
tttgtgtgctccaaagggggaagccttctgtgctgcgagtcctgcccagcagccttccac
cctgactgcctgaacatcgagatgcccgacggcagctggttctgcaatgactgcagggcc
ggcaagaagctccacttccaagatattatttgggttaaacttgggaactacagatggtgg
ccggcagaagtttgccatcccaaaaatgttcccccaaatattcagaaaatgaagcacgag
attggagaattccctgtgtttttctttgggtctaaagattattactggacacatcaggcg
cgagtgttcccgtacatggagggggaccggggcagccgctaccagggggtcagagggatc
ggaagagtcttcaaaaacgcgctacaagaagccgaagctcgttttcgtgaaatcaaactc
caaagggaagccagagagacacaggagaatgagcgcaagcccccgccctacaagcatatt
aaggtgaataagccttacgggaaagtccagatctatacagctgatatttccgaaatcccg
aagtgcaactgtaagcccacagatgagaatccctgtggctttgattcggagtgtttgaac
aggatgctgatgtttgagtgccacccgcaggtgtgtcctgcaggagagtactgccagaac
cagtgtttcaccaagcgccagtaccctgagaccaagatcatcaagacagacggcaaagga
tggggcctggtcgccaagagggacattagaaagggagaatttgtgaatgagtatgttggt
gagctgatagacgaagaggagtgtatggcaagaatcaaatatgcacatgagaacgacatc
actcacttttacatgctcactatagacaaggaccggataattgatgctggccccaaagga
aactattcccgatttatgaatcatagctgccagcccaactgtgagaccctcaagtggaca
gtgaacggtgacactcgcgtgggcctgtttgctgtctgtgacattcctgcagggacggag
ctgacttttaactacaaccttgattgtttgggtaatgaaaaaacagtctgtcggtgcgga
gcctccaactgcagcgggttcctcggggatagaccaaagacctcaacatccctttcttca
gaggagaagggcaaaaagaccaagaaaaaaacccggaggcgtagaacaaaaggtgaagga
aagaagaagtctgaggatgagtgcttccgctgtggcgacgggggccagctggtgctgtgt
gaccgcaagttctgcaccaaggcctaccacctgtcatgcctgggcctgggcaagcggccc
ttcgggaaatgggaatgtccttggcatcattgtgacgtgtgtggcaagccttctacttca
ttttgccacttttgtcccaattcgttttgcaaggaacaccaagatgggacagccttcagc
tctacccaggatgggcggtcatactgctgtgagcatgacttgggggcagagtcagttaga
agtgccaagactgagaaaccctttccagaacccatgaagtcaaaggggaagaggaagaaa
aggaggtgttggcggagggtcaccgaaggcaaatag

DBGET integrated database retrieval system