KEGG   Equus caballus (horse): 100051090Help
Entry
100051090         CDS       T01058                                 

Gene name
WHSC1
Definition
Wolf-Hirschhorn syndrome candidate 1
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ecb00310]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:ecb05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1365 aa AA seqDB search
MEFSIKKNPLSVQKVVKCIKMKQAPEILGNTNGKTQNCEVNRECSVFLSKAQLSTSLQEG
VMQKFNGHDALPFIPTEKLKDLTSRVFNGEPGAHDARLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAATVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISGPSDKKIPAKKESCPSTGKDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVTFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLRLNPHVA
KEAGIAVESLGEMVESSGVTEEAAYNSKPMREEGIPIKRRRRAKLPSSAENQESDPGTVK
TTPQKTAEGDSKRGVGSPSGRKKATASTPRSRKGDAASQFLVFCQKHRDEVVAEHPDASS
EEIEELLGSQWNMLNEKQKARYNTKFALVASSQSEEDSGNLNGKKRNHTKRTQDPTEDVE
VEDAPRKRLRTDKQGLRKREMITDKTARTSSCKAIEAASSLKSQAATKHLSDACKPLKKR
NRASAAASSALAFSKSSSPSASLTENEVSDGQGDEPLESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKTGSLVLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHTCFVC
KENKTDVKRCVVSQCGKFYHEACVRKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQENERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTSLSSEEKGKKTKKKTRRRRTKGEGKKKSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHFCPNSFCKEHQDGTAFSSTQDGR
SYCCEHDLGAESVRSAKTEKPFPEPMKSKGKRKKRRCWRRVTEGK
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaaaaaaaatcctctttctgttcagaaagttgtaaagtgcataaag
atgaagcaggcaccagaaatccttggcaatacaaatggaaagacacagaactgtgaagtg
aatcgcgaatgttctgtattcctcagcaaagcccaactttctaccagtctacaggagggg
gtcatgcagaaatttaatggtcacgatgcacttccttttattccaactgagaagctgaaa
gatctaacttctcgtgtgtttaatggagaacccggtgctcatgatgccagattgcgtttt
gagtcccaggaaatgaaaggaattgggacaccacctaacactacccctatcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacatacatgaatgggaaacctctctttgaa
tcttccatttgtggtgatggtgctgctactgtgtcccagtcagaagaaaatggacaaaaa
ccagaaaataaggcaagaaggaacaggaagagaagcataaaatatgactccttgctggag
cagggccttgtggaagcagctctggtgtccaagatctcgggtccctcagataaaaagatt
ccagctaagaaagagtcctgtccaagtaccggcaaagacaaagaccacctgttgaaatat
aatgttggtgatttggtgtggtccaaagtgtccggttacccttggtggccatgcatggtt
tctgccgatccactccttcacagctataccaaacttaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgtaacttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctgttgaagcctatttcagggaaattgagggcc
cagtgggaaatgggcatcgttcaagcggaagaagctgcaagcatgtccgtagaggagcgg
aaagccaagttcaccttcctctacgtgggggaccagcttcgtctcaaccctcacgtagct
aaggaggcaggcattgctgtggagtctctgggagaaatggtggaatcctcaggagtcact
gaagaagctgcttataactccaagcccatgagagaagagggcattcctatcaagagaagg
cggagagccaagctgcctagctctgctgaaaaccaagaaagtgaccctgggacagtaaag
actactcctcaaaagacagcagagggtgactctaagaggggagtaggatctccttctggg
aggaagaaggccacagcctccactccgcggagcaggaagggagatgcggcatcccagttt
ttggtcttctgtcaaaagcacagggatgaggttgttgctgagcacccagatgcctccagt
gaggagattgaagagttgcttggatcccagtggaacatgctcaatgagaaacagaaagcg
cgctataacacaaagtttgccctagtggcctcttcccagtctgaagaagactctggtaac
ttaaatgggaaaaaaagaaaccacacaaagaggacacaggacccaacagaggacgttgaa
gttgaggatgcacccaggaaaagactcaggaccgacaagcagggtcttcggaagagagag
atgatcactgacaaaacagcccgaacaagctcttgcaaggccatagaggcagcctcctcg
ctgaagagccaggcagcaacgaaacatctgtctgacgcatgcaaaccactgaagaaacga
aatcgggcttctgcagcagcgtcttcagctcttgcgtttagcaaaagttcatctccttct
gcatccttaactgagaatgaggtatcagatggccagggagacgagcccttggagtcccca
tatgaaagtgcagacgaaacgcaaactgaagtgtccgtctcgtctaaaaagtctgaaaga
ggagtaactgccaagaaggagtacgtgtgtcagctgtgtgagaagaccggcagcctcgtg
ctctgcgaaggcccctgttgcggagctttccaccttgcttgccttgggctttcccggaga
ccagaagggaggttcacctgcagcgagtgtgcttcagggattcacacgtgtttcgtgtgt
aaggagaacaagacagatgttaagcgctgtgtcgtatctcagtgtggaaaattttaccat
gaagcttgtgtgagaaaataccctctgactgtgtttgaaagtcgaggctttcgctgccct
ctccacagctgtgtgagctgccatgcttcgaacccttcaaacccaagaccgtcgaaaggt
aaaatgatgcgctgtgttcgctgccccgttgcctatcatggaggggacgcttgtctggca
gcaggctgctcggtgatcgcttccaacagcataatctgcacgggccacttcactgctcgg
aaggggaaaaggcatcatgctcacgtcaatgtgagctggtgctttgtgtgctccaaaggg
ggaagccttctgtgctgcgagtcctgcccagcagccttccaccctgactgcctgaacatc
gagatgcccgacggcagctggttctgcaatgactgcagggccggcaagaagctccacttc
caagatattatttgggttaaacttgggaactacagatggtggccggcagaagtttgccat
cccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgtg
tttttctttgggtctaaagattattactggacacatcaggcgcgagtgttcccgtacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaac
gcgctacaagaagccgaagctcgttttcgtgaaatcaaactccaaagggaagccagagag
acacaggagaatgagcgcaagcccccgccctacaagcatattaaggtgaataagccttac
gggaaagtccagatctatacagctgatatttccgaaatcccgaagtgcaactgtaagccc
acagatgagaatccctgtggctttgattcggagtgtttgaacaggatgctgatgtttgag
tgccacccgcaggtgtgtcctgcaggagagtactgccagaaccagtgtttcaccaagcgc
cagtaccctgagaccaagatcatcaagacagacggcaaaggatggggcctggtcgccaag
agggacattagaaagggagaatttgtgaatgagtatgttggtgagctgatagacgaagag
gagtgtatggcaagaatcaaatatgcacatgagaacgacatcactcacttttacatgctc
actatagacaaggaccggataattgatgctggccccaaaggaaactattcccgatttatg
aatcatagctgccagcccaactgtgagaccctcaagtggacagtgaacggtgacactcgc
gtgggcctgtttgctgtctgtgacattcctgcagggacggagctgacttttaactacaac
cttgattgtttgggtaatgaaaaaacagtctgtcggtgcggagcctccaactgcagcggg
ttcctcggggatagaccaaagacctcaacatccctttcttcagaggagaagggcaaaaag
accaagaaaaaaacccggaggcgtagaacaaaaggtgaaggaaagaagaagtctgaggat
gagtgcttccgctgtggcgacgggggccagctggtgctgtgtgaccgcaagttctgcacc
aaggcctaccacctgtcatgcctgggcctgggcaagcggcccttcgggaaatgggaatgt
ccttggcatcattgtgacgtgtgtggcaagccttctacttcattttgccacttttgtccc
aattcgttttgcaaggaacaccaagatgggacagccttcagctctacccaggatgggcgg
tcatactgctgtgagcatgacttgggggcagagtcagttagaagtgccaagactgagaaa
ccctttccagaacccatgaagtcaaaggggaagaggaagaaaaggaggtgttggcggagg
gtcaccgaaggcaaatag

DBGET integrated database retrieval system