KEGG   Equus caballus (horse): 100051106Help
Entry
100051106         CDS       T01058                                 

Gene name
CAPN1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
ecb  Equus caballus (horse)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ecb04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:ecb04210]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ecb05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 720 aa AA seqDB search
MAEEIITPIYCTGVSAQVQKHRAKELGLGRHENAIKYLGQNYDQLQAQCLQSGVLFRDEA
FPPVPQSLGFKELGPNSSKTYGIKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IACLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDEKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEXLSGGSTSEGFEDFTGGVTEWYEXRKAPSDLYHIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVSLIRMRNPWGE
VEWTGAWSDGSSEWNNVDPYEREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALQS
RKFRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIQLEEPDDPDDDYGGRESGCSF
VLALMQKNRRRERRFGRDMETIGFAVYEPPPLLPSRQLVGQPAVHLKRDFFLANSSRARS
EQFINLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQIQANLPD
EQVLSEQEIDETFKNLFRQLAGTDMEISVRELQTILNRIISKHKDLRTKGFSLESCRSMV
NLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKK
LYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagatcatcaccccaatatactgcaccggggtgtctgcacaagtgcagaag
caccgggccaaggagctgggcctgggccgccatgaaaacgccatcaagtacttgggccag
aattatgaccagctgcaggctcagtgcctgcagagtggggtcctctttcgtgatgaggcc
ttccccccagtgccccaaagcttgggctttaaggaactgggccccaactcctccaaaacc
tatggcatcaagtggaagcgtcccacggagctgttctcaaacccccagttcatcgtggat
ggagctacccgcacagacatctgccagggagccctgggggactgttggctgctggctgcc
atcgcctgcctcaccctcaacgacaccctcctgcaccgagtggttcctcatggccaaagc
ttccagaatggctatgctggcatcttccatttccagctgtggcagtttggggagtgggtg
gacgtggtcgtggatgacctgctgcccaccaaggacgagaagctggtgttcgtgcactcc
gcccaaggcaacgagttctggagcgccctgctcgagaaggcctatgccaaggtgaacggc
agctatgagngcctctcggggggcagcacctcagagggctttgaggactttacaggcggg
gtcaccgagtggtacgagncgcgcaaggcgcccagcgacctctaccacatcatcctcaag
gcgctggaacgaggctccctgctgggctgctccattgacatctccagtgttctggacatg
gaggccgtcaccttcaagaagctggtgaagggccatgcctactctgtgactggggccaag
caggttaactaccagggccagatggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacaggagcctggagtgatggctcctcggagtggaacaacgtggacccttac
gaacgggagcagctccgggtcaagatggaggacggagagttctggatgtcattccgagac
ttcatgcgtgagttcacccgcctggagatctgcaacctgacgcctgacgcgctccagagc
cggaagttccgcaaatggaacaccacgctctacgagggcacctggcggcgggggagcacg
gcggggggctgccggaactacccagccaccttctgggtgaaccctcagttcaagatccag
ctggaggagccagatgacccggatgacgactacgggggccgcgagtcaggctgcagcttc
gtgctcgccctcatgcagaagaaccgccgccgcgagcgccgcttcggccgcgatatggag
accattggcttcgcggtctacgagcccccgcccctccttccctcccgccagctggtgggc
cagccggccgtgcacctgaagcgggacttcttcctggccaactcgtcgcgggcccgatcg
gagcagtttatcaacctgcgcgaggtcagcacccgcttccgcctgccgcccggggagtac
gtggtggtgccgtccaccttcgagcccaacaaggagggcgacttcgtgctacgcttcttc
tcggagaagaaagccgggacccaggagctggacgaccagatccaggccaatctccctgat
gagcaagtgctgtcagaacaggagattgacgagaccttcaagaacctcttcagacaactg
gcagggacggacatggagatcagcgtcagggagctgcagaccattctcaacaggatcatc
agcaaacacaaagacctgcggaccaagggcttcagcctggagtcgtgccgcagcatggtg
aacctcatggatcgggacggcaacgggaagctgggcctggtggagttcaacatcctgtgg
aaccgcatccggaattacctgtccatcttccggaagtttgacttggacaagtcgggcagc
atgagcgcctacgagatgcggatggccatcgagtctgcaggcttcaagctcaacaagaag
ctgtatgagctcattatcacccgctactcggagcccgacctggccgtggactttgacaac
ttcgtgtgctgcctggtgcggctggagaccatgttccggtttttcaaaactctggacaca
gatctggatggagtcgtgacctttgacttgtttaagtggttacagctgaccatgtttgcc
tga

DBGET integrated database retrieval system