KEGG   Equus caballus (horse): 100051230Help
Entry
100051230         CDS       T01058                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
ecb  Equus caballus (horse)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100051230 (MRPS18B)
Ribosome [BR:ecb03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100051230 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 258 aa AA seqDB search
MAASVLNTLLRRLPSLSPFRGAYGVQVPCQTLCTEAPPEEESLPPVPISPYQNEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKTCIRGNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTEAIQKARDHGLLSYHVPLVEPRDLDFSTS
HGAVSAIPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRVREESGPPPESMPEVPL
TTLAEGSSTEQAGPQRAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgtattgaatacgctgctgaggcgcctccctagcctttcgcccttcaga
ggtgcctacggagttcaggttccctgccagactctttgcactgaagccccccctgaggaa
gagtctttgcctccagttcctatttccccttatcagaatgaaccctggaaatacctggac
tcagaagaataccagaatcgctatgggtctcgcccagtctgggctgactaccgtcgcaac
cacaaaggtgggataccgccacagcggactcgaaagacatgtattcgtggaaataaagtt
gctgggaatccctgccctatctgccgggatcacaagctgcatgtcgactttaggaacgtg
aagctcttggaacagtttgtctgcgcccacacgggcatcatcttccatgctccatacaca
ggggtctgtatgaagcagcacaagaagttgaccgaagccatccagaaagccagggatcat
ggtctcctcagttaccacgttcccctggttgaaccgcgggaccttgacttcagtacctct
catggagctgtgagtgctattccaccagcccccaccctggtttcaggtgacccctggtac
ccgtggtacagctggaaacagccaccagagagagagctgtcccgccttcgccggctctat
cagggccgtgtccgagaagagagtggccccccacctgaatcaatgcccgaggttcccctc
acaaccctagctgaaggctcctccactgagcaggcaggcccccagagggctctatag

DBGET integrated database retrieval system