KEGG   Equus caballus (horse): 100051252Help
Entry
100051252         CDS       T01058                                 

Gene name
HDAC5
Definition
histone deacetylase 5
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ecb05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1116 aa AA seqDB search
MNSPSESDGMSGREPSLEILPRTPLHGIPVAVEVKPVLPGAMPSSMGGGGGGSPSPVELR
GALAGPVDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLVLRNKEKSKESAIASTEVKLRLQE
FLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLLGPYDSR
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGAGPGVSS
VCNSAPGSGPSSPNSSHSTIAENGFTGSVPNISTEMLPQHRALPLDSSPNQFSLYTSPSL
PNISLGLQATVTVTNSHITASPKLSSQQEAERQALQSLRQGGALTGKFMSTSSIPGCLLG
VALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPR
HRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHP
EETEEELTEQQEALLGEGALTIPREGSTESESTQEDLEEEEEEEVEEEEEEEEDCIQVKD
EEGESGAEEGPDLEESSAGYKKVFSDVQQLQPLQVYQAPLSLATVPHQALGRTQSSPAAP
GGMKSPPDQPTKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSK
CERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIGV
DSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFN
SVAITTKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGA
PEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAV
EGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVE
LQPLDEAILQQKPNINAVATLEKVIEIQSKHWSCVQRFAAGLGRSLREAQAGETEEAETV
SAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccagcgagtcggatgggatgtcaggccgggaaccgtccttggaaatcctg
cctcggacccctctacacggtatccctgtggcagtggaggtgaagccggtgctgccagga
gccatgcccagctccatggggggcgggggtggaggcagccccagccctgtggagctgcgg
ggtgctctggcaggccctgtggaccccgcgttgcgggagcagcaactgcagcaggagctc
ctggtgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccagaaa
cagcacgaccacctgacacggcagcatgaggtccagctgcagaagcacctcaagcagcag
caggagatgttggcagccaagaggcagcaggagctggagcagcagcggcagcgggaacag
caacggcaggaggagctggagaagcagcggctggagcagcagctgctcgtcctgcgaaac
aaggagaagagcaaagagagtgccatcgccagcactgaggtgaagctgaggctccaggaa
ttcctcctgtcgaagtcaaaggagcccacgccaggcggcctcaaccattccctcccacag
catcccaaatgctggggagcccaccatgcttctttggaccagagttcccctccccagagc
ggtccccctgggacgcctccctcctacaaactgcctttgcttgggccctacgacagccgt
gatgacttccccctccgcaaaacagcctctgaacccaacttgaaagtgcgttcgagacta
aagcagaaggtggccgagcggagaagcagtcccctcctgcgtcgcaaagatgggactgtc
attagcacctttaagaagagagctgtggagatcacaggggctgggcctggagtgtcgtcc
gtgtgtaacagcgcgccaggttctggccccagctctcccaacagctcccacagcaccatc
gctgagaatggctttactggctcagtccccaacatctccaccgagatgctcccccagcac
cgggccctccctctggacagctcccccaaccagttcagcctctacacgtctccctctctg
cccaacatctccctagggctgcaggccacggtcactgtcaccaactcacacatcactgcc
tccccgaagctgtcatcgcagcaggaggccgagaggcaggcccttcagtccctgcggcag
ggtggcgcgttgacgggcaagttcatgagcacatcctccatccctggctgcctgctgggc
gtggcactagagggcgacacgagcccccatggtcacgcctccctgctgcagcatgtgctg
ctgctggagcaggcccggcagcagagtaccctcattgctgtgccacttcacgggcagtcc
ccgctggtgacaggtgaacgcgtggccaccagcatgcggacagtgggcaagctcccgcgg
caccggcccttgagccgcactcagtcttcgccgctaccccagagcccccaggccctgcag
cagctggtcatgcagcagcagcaccagcagttcctggagaagcagaagcagcagcagctg
cagctgggcaagatcctcaccaagactggggagctgccacggcagcccaccacccaccct
gaggagacagaagaggagctgacggagcagcaggaggccttgctgggggagggagccttg
accataccccgagaagggtccacggagagtgagagcacgcaggaagacctggaggaggaa
gaggaggaggaggtagaggaggaggaggaggaggaggaggactgcatccaggtcaaggat
gaggagggcgagagtggcgctgaggaggggcccgacttggaggagtccagtgctggttac
aaaaaggtgttctcagatgtccagcagctgcagccgctgcaggtgtaccaggcacccctc
agcctggccactgtgccccaccaggccctgggccgcacccagtcctcacctgctgcccct
gggggcatgaagagccccccagaccagcccaccaagcacctcttcaccacaggtgtggtc
tacgataccttcatgctcaagcaccagtgcatgtgtgggaacacacatgtgcaccctgag
cacgccggccggattcagagcatctggtccaggctgcaggagacaggcctgcttagcaag
tgcgagcggatccggggtcgcaaagccacgttggatgagatccagactgtgcactccgaa
taccacaccctgctctatgggaccagccccctcaaccgacagaagctggacagcaagaag
ctgctcggccccatcagccagaagatgtacgccatgctgccttgtgggggcatcggggtg
gacagtgacaccgtgtggaacgagatgcactcctccagtgctgtgcgcatggcggtgggc
tgcctggtggagctggctttcaaggtggcggctggagagctcaagaatggatttgccatc
atccgacccccaggacaccatgctgaggaatccacagccatgggattctgcttcttcaac
tctgtagccatcacaaccaaactcctgcaacagaagctgaacgtgggcaaggttctcatc
gtagactgggatattcaccatggcaatggtacccagcaagcgttctacaatgacccctct
gtgctctacatctccctgcatcgctatgacaatgggaacttctttccaggctctggggct
cctgaagaggttggcggtgggccaggcgtggggtacaatgtgaacgtggcatggacggga
ggtgtggacccccccatcggagacgtggagtacctaacggccttcaggacagtggtgatg
cccattgcccacgaattctcacctgacgtggtcctagtctctgccgggtttgatgctgtt
gagggacacctgtctccgctgggtggctactctgtcaccgccagatgttttggccacttg
accaggcagctgatgacgctggcagggggccgggtggtgctggccctggagggaggccac
gacttgaccgccatctgtgatgcctctgaggcctgcgtctcagctctgctcagcgtggag
ctacagcccttggacgaggcaatcttgcagcaaaagcccaacatcaatgcagtggccaca
ctagagaaagtcatcgagatccagagcaaacactggagctgtgtgcagaggtttgccgct
ggtctgggccgttccctgcgggaggcccaggcaggtgagacagaggaggctgagactgtg
agcgccatggccttgctgtcggtgggggctgagcaggcccaggctgctgcagcccgggag
cacagccccaggccagcagaggagcccatggagcaggagcctgccctgtga

DBGET integrated database retrieval system