KEGG   Equus caballus (horse): 100051322Help
Entry
100051322         CDS       T01058                                 

Definition
cell division control protein 42 homolog
Orthology
K04393  
cell division control protein 42
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
GnRH signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bacterial invasion of epithelial cells
Salmonella infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Renal cell carcinoma
Pancreatic cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ecb04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ecb04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ecb04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ecb04370]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ecb04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ecb04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:ecb04510]
Cellular Processes; Cell communication; Adherens junction [PATH:ecb04520]
Cellular Processes; Cell communication; Tight junction [PATH:ecb04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ecb04660]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:ecb04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:ecb04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:ecb04062]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ecb04912]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:ecb04722]
Organismal Systems; Development; Axon guidance [PATH:ecb04360]
Human Diseases; Cancers; Pathways in cancer [PATH:ecb05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:ecb05205]
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:ecb05212]
Human Diseases; Cancers; Renal cell carcinoma [PATH:ecb05211]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:ecb04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:ecb05132]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:ecb05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSQSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSCRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaataagtttccatctgagtatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctcaatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcccatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaacgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagctgcaggtgtgtgctgctatga

DBGET integrated database retrieval system