KEGG   Equus caballus (horse): 100051322Help
Entry
100051322         CDS       T01058                                 

Definition
cell division control protein 42 homolog
Orthology
K04393  
cell division control protein 42
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
GnRH signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bacterial invasion of epithelial cells
Salmonella infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Renal cell carcinoma
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100051322
   04015 Rap1 signaling pathway
    100051322
   04010 MAPK signaling pathway
    100051322
   04370 VEGF signaling pathway
    100051322
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100051322
  Cell motility
   04810 Regulation of actin cytoskeleton
    100051322
  Cellular commiunity
   04510 Focal adhesion
    100051322
   04520 Adherens junction
    100051322
   04530 Tight junction
    100051322
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100051322
   04666 Fc gamma R-mediated phagocytosis
    100051322
   04670 Leukocyte transendothelial migration
    100051322
   04062 Chemokine signaling pathway
    100051322
  Endocrine system
   04912 GnRH signaling pathway
    100051322
  Nervous system
   04722 Neurotrophin signaling pathway
    100051322
  Development
   04360 Axon guidance
    100051322
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051322
   05205 Proteoglycans in cancer
    100051322
   05203 Viral carcinogenesis
    100051322
   05212 Pancreatic cancer
    100051322
   05211 Renal cell carcinoma
    100051322
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100051322
  Infectious diseases
   05132 Salmonella infection
    100051322
   05100 Bacterial invasion of epithelial cells
    100051322
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100051322
  Exosomal proteins of breast milk
   100051322
GTP-binding proteins [BR:ecb04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100051322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSQSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSCRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaataagtttccatctgagtatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctcaatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcccatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaacgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagctgcaggtgtgtgctgctatga

DBGET integrated database retrieval system