KEGG   Equus caballus (horse): 100051541Help
Entry
100051541         CDS       T01058                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100051541 (KAT5)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100051541 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 546 aa AA seqDB search
MAEVVSPVPGAGRREPGEVGRARGPPVADPGAALSPQGEIIEGCRLPVLRRNQDNEDEWP
LAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSR
PGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRST
KRKVEVVSPATPVPSETAPTSVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIP
SAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCL
KYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHK
TLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE
FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEI
TSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDW
SKRGKW
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggtgagtccggtgcccggggcggggcggagggagccaggggaggtgggt
agagcccgaggccccccagtagccgaccctggcgccgcgctgtctccccagggggagata
atcgaaggctgccgcctgcccgtgctgcggcggaaccaggacaacgaagatgagtggccc
ctggccgagatcctgagcgtgaaggacatcagtggccggaagcttttctacgtccattac
attgacttcaataaacgcctggatgaatgggtgacccacgagcggctggacctaaagaag
atccagttccccaagaaggaggccaagacccccaccaagaacggacttcctgggtcccgc
cccggctctccagagagagaggtgccggcctccgcccaggccagcgggaagaccttgcca
atcccggtccagatcacactccgcttcaacctgcccaaggagcgggaggccattcccggt
ggcgagcccgaccagccgctctcctccagctcctgcctgcagcccaaccaccgctcaacg
aaacggaaggtggaggtggtttcaccggcaactcccgtgcccagcgagacagccccgacc
tcagttttcccccagaatggatcagcccgtagggcagtggcagctcagcctggacggaag
cgcaaatcgaattgtttgggcactgatgaggactcccaggacagctcagatggaataccg
tcggctccacgcatgactgggagcctggtgtccgaccggagccacgacgacatcgtcacc
cggatgaagaacatcgagtgcatcgagctgggccggcaccgcctcaagccgtggtacttc
tccccgtacccgcaggagctcaccacgctgcccgtcctctacctctgcgagttctgcctc
aagtacggccggagcctcaagtgtctgcagcgccacttgacgaagtgtgacctgcgacat
cctccaggcaacgagatttaccgcaagggcaccatatccttctttgagatcgatggacgt
aagaacaagagttactcgcagaacctgtgtctcctggcaaagtgtttcctcgaccacaag
acgttgtactatgacacagaccccttcctcttctacgtcatgacggagtacgactgcaag
ggcttccacatcgtgggttacttctccaaggagaaggagtcgacggaagactacaacgtg
gcctgcatcctgaccctgcctccctaccagcgccggggctacggcaagctgctgatagag
ttcagctatgaactctccaaagtggaagggaaaacggggacccctgagaagcccctctca
gatcttggcctcctatcctaccgaagctactggtcccagaccatcctggagatcctgatg
gggctgaagtcggagagtggggagaggccgcagatcaccatcaacgagatcagtgaaatc
accagcatcaagaaggaggatgtcatctccactctacagtacctcaaccttatcaactac
tacaagggccagtacattctcacactgtcggaggacatcgtggatgggcatgaacgggct
atgctcaagcggctccttcggatcgactccaagtgtctccacttcactcccaaggactgg
agcaagagggggaagtggtga

DBGET integrated database retrieval system