KEGG   Equus caballus (horse): 100051546Help
Entry
100051546         CDS       T01058                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
ecb  Equus caballus (horse)
Pathway
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051546 (RARB)
   05226 Gastric cancer
    100051546 (RARB)
   05222 Small cell lung cancer
    100051546 (RARB)
   05223 Non-small cell lung cancer
    100051546 (RARB)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100051546 (RARB)
Nuclear receptors [BR:ecb03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100051546 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 100051546
NCBI-ProteinID: XP_001494165
Ensembl: ENSECAG00000016976
Position
16
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatctattgaaacacagagcaccagc
tctgaggaactcgtcccgagccctccgtctccacttcctccccctcgtgtgtacaaaccc
tgcttcgtctgccaggacaagtcatcggggtaccactatggagtcagcgcctgtgagggg
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagccttcgaagcaggaatgcacggaaagctatgaaatgacggctgagctggatgatctc
acagagaagatccgaaaagctcaccaggaaaccttcccctcgctctgccagctgggtaaa
tacaccacgaattccagcgctgaccatagagtccgactggacctgggcctctgggacaaa
ttcagcgaactggccaccaagtgcattattaagatcgtggagtttgctaagcgtctgccg
ggcttcactggcctgaccatcgcagaccaaatcaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttttca
gatggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggatcttgaggaaccaacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaagagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgcagcatc
agcgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaggaaatgctggaaaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcccagcatctcacccagttcagtggaaaacagcggc
gtcagccagtcaccactggtgcaatga

DBGET integrated database retrieval system