KEGG   Equus caballus (horse): 100051546Help
Entry
100051546         CDS       T01058                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
ecb  Equus caballus (horse)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:ecb05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:ecb05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:ecb05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatctattgaaacacagagcaccagc
tctgaggaactcgtcccgagccctccgtctccacttcctccccctcgtgtgtacaaaccc
tgcttcgtctgccaggacaagtcatcggggtaccactatggagtcagcgcctgtgagggg
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagccttcgaagcaggaatgcacggaaagctatgaaatgacggctgagctggatgatctc
acagagaagatccgaaaagctcaccaggaaaccttcccctcgctctgccagctgggtaaa
tacaccacgaattccagcgctgaccatagagtccgactggacctgggcctctgggacaaa
ttcagcgaactggccaccaagtgcattattaagatcgtggagtttgctaagcgtctgccg
ggcttcactggcctgaccatcgcagaccaaatcaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttttca
gatggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggatcttgaggaaccaacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaagagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgcagcatc
agcgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaggaaatgctggaaaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcccagcatctcacccagttcagtggaaaacagcggc
gtcagccagtcaccactggtgcaatga

DBGET integrated database retrieval system