KEGG   Equus caballus (horse): 100051552Help
Entry
100051552         CDS       T01058                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100051552
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100051552
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP4 family
   100051552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 507 aa AA seqDB search
MESSWLATRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFYGHQKL
LQDGKMEKLEELVEKYPCAFPCWVGPFQAFFYIYDPDYAKTFLSRTDPKSKYPCKVLLPC
LGKGLVSLDGPKWFQHRCLLTPGYSVNILKSYVEVMAHSVNMMLGKWEKICGTQDTIVEV
FEHINLMALDILMKCAFSQETNCQINSHCDLYVKSTFEASKIIFYRLYSFLRHHNILFNF
SPEGHRLQETSQMLHQHTEKAIQDRKKALEEEKRQDNTQKRKHQDFLDVVLSVQAENRDS
FSDTDLRSEVNTFLLAGQDTMPGAISWLLYHLALNPEHQERCREEIRSILGDGSSITWDQ
LDEMSYTTMCIKESLRLAPPVPSISRELSKPITFPDGLSLPAGITVVLSIWGLHHNPAIW
KKPKVFDPLRFSQENSDQRHSHSFLPFSAGPRNCVGQHFAMAELKVAIALILLRFKVTPD
PTRPLVFLSQVIRKPKNGVHLHLKKLS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcctggctagcgacgcgctgggcgcggcccttttacctggctttcgtgttc
tgcctggccctcgggctgctgcaggccatcaagctgtacctgcggaggcagcggctgctg
cgagacctgcgccccttccccgcgccccccacccactggttctacgggcaccaaaagtta
cttcaggatggtaaaatggagaagcttgaggagcttgtcgaaaaatacccttgtgccttt
ccttgctgggttgggcccttccaggcatttttctatatctatgacccagactatgcgaag
acatttctgagcagaacagatcccaagtccaagtacccatgcaaggtcttgcttccatgt
cttggaaaaggactagtgagtctcgatggacccaagtggttccagcaccgttgcctatta
actcctggatacagtgttaacatcttgaaatcatatgtcgaggtgatggcccattctgtg
aacatgatgttgggcaagtgggagaagatttgtggcactcaggacacgatcgtggaggtc
tttgagcacatcaacttgatggccctggacatactcatgaaatgtgctttcagccaggag
accaactgccagataaacagccactgtgatctttatgtaaaatcgacatttgaagccagc
aaaatcatcttttatcgcttgtacagtttcttacgtcaccacaacatacttttcaacttc
agccctgagggtcaccgcttacaggagaccagccaaatgctgcatcagcacacagaaaag
gcaatccaggatagaaagaaagccctcgaggaagagaagaggcaggataacactcagaag
aggaagcaccaggattttctggatgttgtcctttctgtccaggctgaaaatcgtgacagc
ttctcagacactgacctgcggtccgaggtgaacacattcttgttggcagggcaggacacc
atgccaggggccatttcctggctcctctaccacctggctctgaaccctgagcatcaggag
agatgccgggaggagatcaggagcatcctgggagatgggtcttccattacctgggaccag
ctggatgagatgtcatacaccacaatgtgcatcaaggagtcactccgattggctcctcca
gtcccatccatttccagagaactcagcaagcccattaccttcccagatggactctccttg
cctgcaggaataactgtggttctcagtatttggggtcttcaccataaccctgccatctgg
aaaaaaccaaaggtctttgaccccttgaggttctcccaggagaattctgatcagagacac
tcccactccttcttaccattctcagctggaccaaggaactgcgtcgggcagcattttgcc
atggctgagttaaaggtggccattgctttgattctgctccgcttcaaggtgactccagac
cccaccaggcctcttgtcttcttgtcccaggttatccgcaaacccaagaatggggtccac
ttgcatctgaagaaactctcctaa

DBGET integrated database retrieval system