KEGG   Equus caballus (horse): 100051558Help
Entry
100051558         CDS       T01058                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04062  Chemokine signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04310  Wnt signaling pathway
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04621  NOD-like receptor signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04911  Insulin secretion
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04918  Thyroid hormone synthesis
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing's syndrome
ecb04961  Endocrine and other factor-regulated calcium reabsorption
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb04972  Pancreatic secretion
ecb05010  Alzheimer's disease
ecb05016  Huntington's disease
ecb05142  Chagas disease (American trypanosomiasis)
ecb05143  African trypanosomiasis
ecb05146  Amoebiasis
ecb05200  Pathways in cancer
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100051558 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100051558 (PLCB1)
   04310 Wnt signaling pathway
    100051558 (PLCB1)
   04371 Apelin signaling pathway
    100051558 (PLCB1)
   04020 Calcium signaling pathway
    100051558 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100051558 (PLCB1)
   04072 Phospholipase D signaling pathway
    100051558 (PLCB1)
   04071 Sphingolipid signaling pathway
    100051558 (PLCB1)
   04022 cGMP - PKG signaling pathway
    100051558 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100051558 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100051558 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100051558 (PLCB1)
   04062 Chemokine signaling pathway
    100051558 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    100051558 (PLCB1)
   04922 Glucagon signaling pathway
    100051558 (PLCB1)
   04912 GnRH signaling pathway
    100051558 (PLCB1)
   04915 Estrogen signaling pathway
    100051558 (PLCB1)
   04921 Oxytocin signaling pathway
    100051558 (PLCB1)
   04926 Relaxin signaling pathway
    100051558 (PLCB1)
   04918 Thyroid hormone synthesis
    100051558 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100051558 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100051558 (PLCB1)
   04916 Melanogenesis
    100051558 (PLCB1)
   04924 Renin secretion
    100051558 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100051558 (PLCB1)
   04927 Cortisol synthesis and secretion
    100051558 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100051558 (PLCB1)
   04270 Vascular smooth muscle contraction
    100051558 (PLCB1)
  Digestive system
   04970 Salivary secretion
    100051558 (PLCB1)
   04971 Gastric acid secretion
    100051558 (PLCB1)
   04972 Pancreatic secretion
    100051558 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100051558 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    100051558 (PLCB1)
   04725 Cholinergic synapse
    100051558 (PLCB1)
   04728 Dopaminergic synapse
    100051558 (PLCB1)
   04726 Serotonergic synapse
    100051558 (PLCB1)
   04720 Long-term potentiation
    100051558 (PLCB1)
   04730 Long-term depression
    100051558 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100051558 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051558 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    100051558 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051558 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100051558 (PLCB1)
   05016 Huntington's disease
    100051558 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051558 (PLCB1)
   04934 Cushing's syndrome
    100051558 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    100051558 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    100051558 (PLCB1)
   05143 African trypanosomiasis
    100051558 (PLCB1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100051558 (PLCB1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100051558 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100051558 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 100051558
NCBI-ProteinID: XP_023481898
Ensembl: ENSECAG00000021224
Position
22
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSAIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKCIGHRILPVQAIRPGYHYISLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPSLASDPGKLNHRPPSS
EELEGDNPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgctttgcaactcaagcctgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactctgctattgtcactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctgttagatctcagccttgtcaaggatgccagatgcgggaagcatgccaaagct
cccaaggaccccaagttgcgtgaacttttggatgtgggaaacatcgggcgcctggaacat
cgcatgataacggtggtatatgggcctgacttagttaacatctcccatttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggtttttagtttggcaacaaac
ctgctggcccaaaacatgtccagggacgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcgaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttccgaatttggtgccaaaagcaaaccatacctt
actgttgatcagatgatggattttatcaatcttaaacagcgagatcctcggctaaatgaa
atactttacccacctttaaagcaagaacaagtccaagtattgattgagaagtatgaaccc
aacaatagtctcgccaaaaaaggacagatatcagtggacggattcatgcgctatctgagt
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagatatgtctcag
cctctttctcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcctccgtcgagatgtaccgccaagtgcttctgtctggttgtcgctgcgta
gagttggactgctggaagggacggaccgcagaagaggaaccagtcatcacccatgggttc
accatgacaactgaaatatccttcaaggaagtgatagaagcaattgctgagtgtgcattt
aagacttcaccttttccaattctgctttcatttgagaaccacgtggactccccaaagcag
caagccaagatggcggagtattgccggctcatctttggggacgcccttctcatggaacca
ctggaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataaaaagaagtcacacaagtcatcagaaggaagtggcaaaaag
aagctctcggaacaagcctccaacacgtacagcgactcctccagtgtgttcgagccctcg
tctccgggagccggggaagctgacacagagagcgacgatgatgacgatgacgatgactgt
aaaaaatcttcaatggatgagggcactgctgggagcgaggccatggccacagaagagatg
tctaacctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaatagaagttttgaaatgtcttccttcgtggaaaccaaaggacttgagcaacttacg
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
gggacacgcgtggattcatccaactacatgcctcagctcttctggaacgcaggttgccaa
atggttgcccttaatttccaaacagtggacctggctatgcaaataaatatggggatgtat
gaatataacgggaagagtggctacagattaaagccagagttcatgaggagacctgataag
cattttgatccattcactgaaggcatcgttgatgggatagtggccaacactttatctgtt
aagattatttccggtcagtttctttctgataagaaagttgggacttacgtagaagtggac
atgttcggtttgccggtggacacaaggaggaaggcattcaagaccaagacatcacaagga
aacgctgtcaatcccgtctgggaagaagaacccattgtcttcaaaaaggtggtccttcct
tctctggcctgtttgaggatagcagtttatgaagaaggaggcaaatgtatcggtcaccgg
atcttgccagtgcaagcaattcgaccaggctatcactacatctctctgaggaatgagagg
aaccagcctctgatgctaccagctgtctttgtctacatagaggtgaaagactatgtccca
gatacatatgcagatgtgattgaagctttgtcaaatccaatccgctatgtgaatctgatg
gagcagagagctaagcaactggctgctttgacactggaagatgaagaagaagtgaagaaa
gaggctgatcctggggaaacaccatcggaggctccgagtgaagccaggacaactccagca
gaaaacggagtgaatcacactacatccctgacacctaaacctccctcccaggctctccac
agccagccagctccaggttctgtaaaggcaccggccaaaacagaagatctcattcagagt
gttttaacagaagtggaagcgcagactattgaagagctaaagcaacagaaatcgttcgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagagcacactacaaaatataatgaaattcagaatgactacttg
agaaggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcggaaccc
agcagtcctgaccatggttcatcgacaattgagcaagaccttgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacagcagcagcagctgcttaatcttcga
caagaacagtattatagtgaaaaataccagaagcgagaacatattaagttgcttattcaa
aaattgacggatgttgctgaagaatgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagagaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaagaggaaaagacagagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcgcaaagtaaacga
caagaaaaactggtagagaaacacaaggagatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagagtaccaagacaagttcaaaagactacccctggag
attttggagttcgtgcaggaagccatgaaagggaaaatcagtgaagacagcaatcacagt
tctgcccctccctctctggcctcagaccctggcaaactgaaccacagacctccctccagt
gaggagctggaaggagacaacccaggaaaagagtttgataccccgctgtga

DBGET integrated database retrieval system