KEGG   Equus caballus (horse): 100051684Help
Entry
100051684         CDS       T01058                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
ecb  Equus caballus (horse)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100051684 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100051684 (ADRA2B)
G protein-coupled receptors [BR:ecb04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100051684 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 454 aa AA seqDB search
MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVTRALEY
NTKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSHLRGPRAKGGPGGGGSKQPHPVPAGASASAKLPTVASC
LAAAGEANGHSEPTGEKEAETPEDSGTPALPPSWPALPSSGQDQKEGVCGASLEEEAEEE
EEEEEEEEEGEEECEPQALPASPASACSPPLQQPQGSRVLATLRGQVLLGRGVATAGAQW
WRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGY
CNSSLNPVIYTIFNQDFRRAFRRILCRQWTQTAW
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggagccctactccgtgcaggccactgcagccattgcggcggtcatcacc
ttcctcatcctcttcaccatctttggcaacgcgctggtcatcctggctgtgttgacgagc
cgctcgctgcgcgccccgcagaacctgttcctggtgtcgctggccgctgccgacatcctg
gtggccacgctcatcatccctttctcgttggccaatgagctgctgggctactggtacttc
cggcgcacgtggtgtgaggtgtacctggcgctcgacgtgctcttctgtacgtcttccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgacgcgcgcgctggagtac
aacaccaagcgcaccccgcgccgcatcaagtgcatcatcctcaccgtgtggctcatcgca
gctgtcatctcgctgccgccccttatctacaagggggaccagggcccccagccgcgcggg
cggccgcagtgcaagctcaaccaagaggcctggtatatcctggcctccagcatcggatcc
ttctttgcaccctgcctcatcatgatccttgtctacctgcgcatctacctgattgctaaa
cgcagccacctcagaggtcccagggccaagggaggccctgggggaggtgggtctaagcag
ccccacccagtccctgcaggagcttcagcctcagccaaactgcccactgtggcctcttgt
ctggctgctgccggagaggccaatggacactccgagcccactggggagaaggaggcagag
acccctgaagattctgggacccctgccttgccccccagctggcctgcccttcctagttca
ggccaggatcagaaggaaggagtttgtggggcatctctggaggaggaagctgaagaggag
gaggaagaggaggaggaggaggaggagggggaggaagagtgtgagcctcaggcgttgcca
gcatctcctgcctcagcttgcagcccacccctgcagcagccacagggctcccgggtgctg
gcgaccctacgtggccaggtgctcctgggcaggggtgtggccactgcaggtgcgcagtgg
tggcggcggcgggcacagctgactcgggagaagcggttcaccttcgtgctggccgtggtc
attggcgtcttcgtgctctgctggttccccttcttcttcagctacagcctgggtgccatc
tgcccccagcactgcaaggtgccccacggcctcttccagttctttttctggatcggctac
tgcaacagctcgctgaaccccgtcatctacaccatcttcaaccaggactttcgccgtgcc
ttccgaaggatcctttgccgccagtggacccagacggcatggtga

DBGET integrated database retrieval system