KEGG   Equus caballus (horse): 100051707Help
Entry
100051707         CDS       T01058                                 

Gene name
DYRK1A
Definition
(RefSeq) dual specificity tyrosine phosphorylation regulated kinase 1A
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100051707 (DYRK1A)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100051707 (DYRK1A)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100051707 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
26
AA seq 753 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSH
KKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKI
IKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLL
RNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFG
SSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQ
MNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGTRKLHNILGV
ETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNT
SNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQAM
DCETHSPQVRQQFALLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHH
HHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSS
STGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAH
YMTEGHLTMRQGADREESPMTGVCVQQSPVASS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccgtca
ttttcattccatgctgctggccttcagatggctggacagatgccccattcacatcagtac
agtgaccgtcgccagccaaacataagtgaccaacaggtttctgccttatcttattctgac
cagattcaacaacctctcactaaccagaggcggatgccccaaaccttccgtgatccagca
actgctcccctgagaaaactttctgttgacttgatcaaaacatataagcatattaatgag
gtttactatgcaaaaaagaagcgaagacaccaacagggccagggagacgattctagtcat
aagaaggagcggaaggtttacaatgatggttatgatgatgataactatgattatattgta
aagaacggagaaaagtggatggatcgttacgaaattgactccttgataggcaaaggttcc
tttggacaggttgtaaaggcatatgatcgtgtggaacaagaatgggttgccattaaaata
ataaagaacaagaaagcttttctgaatcaagcccagatagaagtgcgacttcttgagctc
atgaacaaacatgacactgaaatgaaatactatatagtgcatttgaaacgccactttatg
tttcgaaaccatctctgtttagtttttgaaatgctgtcctacaacctctatgacttgttg
aggaacaccaattttcgaggtgtctctttgaacctaacacgaaagtttgcacagcagatg
tgcactgcactgcttttccttgcgactccagaacttagtatcattcactgtgacctaaaa
cctgagaatatccttctttgtaaccccaaacgcagtgcaatcaagatcgttgactttggc
agttcttgtcaattggggcaaaggatataccagtatattcagagtcgcttttatcggtct
ccagaggtgctactgggaatgccttacgaccttgctatcgacatgtggtcccttgggtgt
attttggttgaaatgcacactggagaacctctgttcagtggagccaatgaggtagatcag
atgaataaaatagtggaagttctgggtattccacctgctcatattcttgaccaagcacca
aaagcaagaaagttctttgagaagttgccagatggcacttggaacttaaagaagaccaaa
gatggaaaacgggagtataaaccaccaggaacccgtaagcttcataatattcttggagta
gaaacaggaggacctggtgggcgtcgtgctggggagtcgggtcatacggtagctgactac
ttgaagttcaaagacctcattttaaggatgcttgattatgaccccaaaactcgaattcaa
ccttactatgccctgcagcacagttttttcaagaaaacagctgatgaaggtacaaatacg
agtaatagtgtatccacaagtcctgcaatggagcagtcacagtcctcggggaccacctcc
agtacatcttcaagctcaggtggatcatcggggacaagcaacagtgggagagccaggtcg
gatcccacgcaccagcatcggcacagtggcgggcacttcactgccgccgtccaggccatg
gactgtgagacacacagtccccaggtgcgtcagcaattcgctctccttggttggtcaggc
actgaagctcctacacaagtcactgttgaaactcatcccgttcaagaaacaacctttcat
gtagcccctcaacagaatgcattgcatcatcaccatggaaacagttcccatcaccatcac
caccaccaccaccaccaccaccaccatggacaacaagcgttgggtaaccggaccaggcca
agggtctacaattctccaacgaatagctcctctacccaggattctatggaggttggccat
agtcaccactccatgacatccctgtcttcctcaactacttcttcctctacatcttcctcc
tctactggtaatcaaggcaatcaggcctaccagaatcgcccagtggctgctaataccttg
gactttggacagaatggagctatggacgttaatttaaccgtctactccaatccccgccaa
gagactggcatagctggacatccaacttaccaattttctgctaatacaggtcctgcacat
tacatgactgaaggacatctgacaatgaggcaaggggctgatagagaagagtcccccatg
acaggagtttgtgtgcaacagagtcctgtagctagctcgtga

DBGET integrated database retrieval system