KEGG   Equus caballus (horse): 100051714Help
Entry
100051714         CDS       T01058                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2 (muscle)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100051714 (PGAM2)
   01230 Biosynthesis of amino acids
    100051714 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100051714 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100051714 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100051714 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100051714 (PGAM2)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100051714 (PGAM2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100051714 (PGAM2)
  Exosomal proteins of melanoma cells
   100051714 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGAEEAKRGAHAIKDAKMEFDICYTSVL
KRAIRTLWTILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYSSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIAPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMDLNLPTGIPIVYELDAALKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgcctcgtgatggttcggcacggcgagagcacctggaaccaggagaac
cgcttctgtggctggtttgatgcagagctgagcgagaagggggccgaggaggccaagagg
ggagcccatgccatcaaggacgccaagatggagttcgacatctgctacacgtcggtgctg
aagcgggccatccgcaccctctggaccatcctggatggcacggaccagatgtggctgcct
gtggtgcgcacctggcgtctcaatgagcggcactatgggggcctcacaggcctcaacaag
gcggagacagccgccaaacacggggaggagcaggtgaagatctggaggcgctcctttgac
atccctccaccccccatggatgagaagcacccctactacagctccatcagcaaggagcgt
cggtatgcaggcctgaagcctggggaactgcccacttgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaatgaggagatcgccccccaaatcaaggctggcaagaga
gtgctcatcgcggcccacgggaacagccttcggggcatcgtcaagcatctggaagggatg
tccgaccaggccatcatggacctgaacctgcccacggggatccccatcgtgtatgagctg
gacgcagcactgaagcccaccaagcccatgcggttcctgggtgacgaggagactgtacgg
aaggccatggaggccgtggctgcccagggcaaggccaagtga

DBGET integrated database retrieval system