KEGG   Equus caballus (horse): 100051753Help
Entry
100051753         CDS       T01058                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  Jak-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04960  Aldosterone-regulated sodium reabsorption
ecb04973  Carbohydrate digestion and absorption
ecb05100  Bacterial invasion of epithelial cells
ecb05142  Chagas disease (American trypanosomiasis)
ecb05146  Amoebiasis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  HTLV-I infection
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05418  Fluid shear stress and atherosclerosis
Module
ecb_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100051753 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100051753 (PIK3CB)
   04015 Rap1 signaling pathway
    100051753 (PIK3CB)
   04012 ErbB signaling pathway
    100051753 (PIK3CB)
   04370 VEGF signaling pathway
    100051753 (PIK3CB)
   04630 Jak-STAT signaling pathway
    100051753 (PIK3CB)
   04668 TNF signaling pathway
    100051753 (PIK3CB)
   04066 HIF-1 signaling pathway
    100051753 (PIK3CB)
   04068 FoxO signaling pathway
    100051753 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100051753 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100051753 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100051753 (PIK3CB)
   04024 cAMP signaling pathway
    100051753 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100051753 (PIK3CB)
   04152 AMPK signaling pathway
    100051753 (PIK3CB)
   04150 mTOR signaling pathway
    100051753 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100051753 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    100051753 (PIK3CB)
   04218 Cellular senescence
    100051753 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100051753 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100051753 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100051753 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100051753 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100051753 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100051753 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100051753 (PIK3CB)
   04660 T cell receptor signaling pathway
    100051753 (PIK3CB)
   04662 B cell receptor signaling pathway
    100051753 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100051753 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100051753 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100051753 (PIK3CB)
   04062 Chemokine signaling pathway
    100051753 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    100051753 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    100051753 (PIK3CB)
   04915 Estrogen signaling pathway
    100051753 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100051753 (PIK3CB)
   04917 Prolactin signaling pathway
    100051753 (PIK3CB)
   04926 Relaxin signaling pathway
    100051753 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100051753 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100051753 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100051753 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    100051753 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100051753 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051753 (PIK3CB)
  Development
   04360 Axon guidance
    100051753 (PIK3CB)
   04380 Osteoclast differentiation
    100051753 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    100051753 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100051753 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051753 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100051753 (PIK3CB)
   05231 Choline metabolism in cancer
    100051753 (PIK3CB)
   05205 Proteoglycans in cancer
    100051753 (PIK3CB)
   05203 Viral carcinogenesis
    100051753 (PIK3CB)
   05210 Colorectal cancer
    100051753 (PIK3CB)
   05212 Pancreatic cancer
    100051753 (PIK3CB)
   05225 Hepatocellular carcinoma
    100051753 (PIK3CB)
   05226 Gastric cancer
    100051753 (PIK3CB)
   05214 Glioma
    100051753 (PIK3CB)
   05221 Acute myeloid leukemia
    100051753 (PIK3CB)
   05220 Chronic myeloid leukemia
    100051753 (PIK3CB)
   05218 Melanoma
    100051753 (PIK3CB)
   05211 Renal cell carcinoma
    100051753 (PIK3CB)
   05215 Prostate cancer
    100051753 (PIK3CB)
   05213 Endometrial cancer
    100051753 (PIK3CB)
   05224 Breast cancer
    100051753 (PIK3CB)
   05222 Small cell lung cancer
    100051753 (PIK3CB)
   05223 Non-small cell lung cancer
    100051753 (PIK3CB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100051753 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100051753 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100051753 (PIK3CB)
   04931 Insulin resistance
    100051753 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051753 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100051753 (PIK3CB)
   05166 HTLV-I infection
    100051753 (PIK3CB)
   05162 Measles
    100051753 (PIK3CB)
   05164 Influenza A
    100051753 (PIK3CB)
   05161 Hepatitis B
    100051753 (PIK3CB)
   05160 Hepatitis C
    100051753 (PIK3CB)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100051753 (PIK3CB)
   05169 Epstein-Barr virus infection
    100051753 (PIK3CB)
   05165 Human papillomavirus infection
    100051753 (PIK3CB)
   05146 Amoebiasis
    100051753 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    100051753 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100051753 (PIK3CB)
   01524 Platinum drug resistance
    100051753 (PIK3CB)
   01522 Endocrine resistance
    100051753 (PIK3CB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100051753 (PIK3CB)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100051753 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 100051753
NCBI-ProteinID: XP_001495466
Ensembl: ENSECAG00000023941
Position
16
AA seq 1070 aa AA seqDB search
MCFNFMMPPAMADSLDIWSVDSQIVSDGSIRVDFLLPTGIYIQLDVPREAPISYIKQMLW
KQVCDYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRVKMRKFSEEKIQSLVGLSWMDWLQQTYPPEH
EPSNLENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIRGKEDE
VSPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRVISHIWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVNCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYTNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcaacttcatgatgcctcctgctatggcagacagccttgacatctggtcagtg
gattcacagatagtatctgatggctccatacgtgtggatttccttttacccactgggatt
tatatccagttggacgtacctcgggaagctcccatttcctatattaaacagatgttatgg
aagcaagtttgcgattacccaatgtttaaccttcttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtgtatgaggagcttgaagatgaaacaagaagactgtgt
gatgtccgaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgatgccttg
aaggatcctgaggtgaatgaattccgagtaaaaatgcgaaaattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctacagcagacatatccaccagagcat
gaaccctctaaccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtttgactattcgtgggaaagaagatgaa
gtcagcccttgtgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgac
cacccattaattcagttccagtatatccggaactgtgtaatgaataggaccttgccccat
tttatacttgtggaatgttgcaagatcaaaaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttccccttcctttaccaccaaagaaaacg
cgagttatttctcacatttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcacgtcagagctggcctttttcatggt
actgaacttctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatattaatacttgtgacctgccacgaatggctcgatta
tgttttgcagtttatgcagttttggataaagtgaaaacaaagaaatcaactaaaactatt
aatccctctaaatatcagaccatcaggaaatctgggaaagtgcattatccagtagcatgg
gtaaatacgatggtttttgactttaaaggacaattgagatctggagatgtaatattgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattaccctcccttcgataagattatcgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactcaaagaa
atcttggacagggatcccctgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgagacaagactgcagagagaatttcccacagtcactgccaaaattattgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctacccccccgggaggccctggagcttctagatttcaactatccagatcagtacgtgcgg
gaatatgctgtgaactgcctgcgacagatgagcgatgaagaactctctcaatatctttta
caactggtgcaagttttaaaatatgagccttttttggattgtgccctctctagattccta
ttagaaagagcacttgccaatcggaggatagggcagtttctattttggcacctcaggtca
gaagtgcacattcctgctgtctctgtgcaatttggtgtcattcttgaagcatactgccgg
gggagcgtagggcacatgaaagtgctttccaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagctaaacagagccaaagggaaagag
gccatgcacacctgtttaaaacagaatgcttaccgggaggccctctctgacctgcagtca
cctctgaacccgtgtgtcatcctctcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctggtgtacaccaacaaggtgtttggggaagattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccagatgctg
cgcttgatggatttgctctggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaataaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaagag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttggaattggtgacaga
catagcgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccaatgttgtgaggatgcgtatctgattttacgacgacatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccctagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtaaactggatg
gcccacacagtccggaaagactaccgatcttaa

DBGET integrated database retrieval system