KEGG   Equus caballus (horse): 100051798Help
Entry
100051798         CDS       T01058                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04137  Mitophagy - animal
ecb04140  Autophagy - animal
ecb04141  Protein processing in endoplasmic reticulum
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04217  Necroptosis
ecb04310  Wnt signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04530  Tight junction
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04664  Fc epsilon RI signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04723  Retrograde endocannabinoid signaling
ecb04728  Dopaminergic synapse
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04917  Prolactin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04926  Relaxin signaling pathway
ecb04930  Type II diabetes mellitus
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05164  Influenza A
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex infection
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05231  Choline metabolism in cancer
ecb05418  Fluid shear stress and atherosclerosis
Module
ecb_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100051798 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100051798 (MAPK8)
   04010 MAPK signaling pathway
    100051798 (MAPK8)
   04012 ErbB signaling pathway
    100051798 (MAPK8)
   04310 Wnt signaling pathway
    100051798 (MAPK8)
   04668 TNF signaling pathway
    100051798 (MAPK8)
   04068 FoxO signaling pathway
    100051798 (MAPK8)
   04071 Sphingolipid signaling pathway
    100051798 (MAPK8)
   04024 cAMP signaling pathway
    100051798 (MAPK8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100051798 (MAPK8)
   04137 Mitophagy - animal
    100051798 (MAPK8)
  Cell growth and death
   04210 Apoptosis
    100051798 (MAPK8)
   04215 Apoptosis - multiple species
    100051798 (MAPK8)
   04217 Necroptosis
    100051798 (MAPK8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100051798 (MAPK8)
   04530 Tight junction
    100051798 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100051798 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100051798 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100051798 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100051798 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100051798 (MAPK8)
   04659 Th17 cell differentiation
    100051798 (MAPK8)
   04657 IL-17 signaling pathway
    100051798 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100051798 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    100051798 (MAPK8)
   04920 Adipocytokine signaling pathway
    100051798 (MAPK8)
   04912 GnRH signaling pathway
    100051798 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100051798 (MAPK8)
   04917 Prolactin signaling pathway
    100051798 (MAPK8)
   04926 Relaxin signaling pathway
    100051798 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    100051798 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100051798 (MAPK8)
   04722 Neurotrophin signaling pathway
    100051798 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051798 (MAPK8)
  Development
   04380 Osteoclast differentiation
    100051798 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051798 (MAPK8)
   05231 Choline metabolism in cancer
    100051798 (MAPK8)
   05210 Colorectal cancer
    100051798 (MAPK8)
   05212 Pancreatic cancer
    100051798 (MAPK8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100051798 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100051798 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100051798 (MAPK8)
   04931 Insulin resistance
    100051798 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100051798 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    100051798 (MAPK8)
   05133 Pertussis
    100051798 (MAPK8)
   05152 Tuberculosis
    100051798 (MAPK8)
   05164 Influenza A
    100051798 (MAPK8)
   05161 Hepatitis B
    100051798 (MAPK8)
   05160 Hepatitis C
    100051798 (MAPK8)
   05168 Herpes simplex infection
    100051798 (MAPK8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100051798 (MAPK8)
   05169 Epstein-Barr virus infection
    100051798 (MAPK8)
   05145 Toxoplasmosis
    100051798 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    100051798 (MAPK8)
  Drug resistance
   01522 Endocrine resistance
    100051798 (MAPK8)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100051798 (MAPK8)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100051798 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 100051798
NCBI-ProteinID: XP_023504073
Ensembl: ENSECAG00000008480
Position
1
AA seq 427 aa AA seqDB search
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaagcctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaagcgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaagtccctagaagaa
tttcaggatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctaggcatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttatcgaacag
cttggaacaccatgtcctgaattcatgaagaaactacagccaacagtaaggacttatgtc
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttattatccaaa
atgctggtgattgacgcgtctaaaaggatctctgtggatgaagcgctccagcacccgtac
atcaatgtctggtatgacccttcggaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacgatagaagagtggaaagaattgatatacaaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcgacagatccaactttggcctcggatacagacagcagtcttgaagcatctgct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system