KEGG   Equus caballus (horse): 100051798Help
Entry
100051798         CDS       T01058                                 

Gene name
MAPK8
Definition
mitogen-activated protein kinase 8
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Salmonella infection
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100051798 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100051798 (MAPK8)
   04010 MAPK signaling pathway
    100051798 (MAPK8)
   04012 ErbB signaling pathway
    100051798 (MAPK8)
   04310 Wnt signaling pathway
    100051798 (MAPK8)
   04668 TNF signaling pathway
    100051798 (MAPK8)
   04068 FoxO signaling pathway
    100051798 (MAPK8)
   04024 cAMP signaling pathway
    100051798 (MAPK8)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100051798 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100051798 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100051798 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100051798 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100051798 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    100051798 (MAPK8)
   04920 Adipocytokine signaling pathway
    100051798 (MAPK8)
   04912 GnRH signaling pathway
    100051798 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100051798 (MAPK8)
   04917 Prolactin signaling pathway
    100051798 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    100051798 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100051798 (MAPK8)
   04722 Neurotrophin signaling pathway
    100051798 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100051798 (MAPK8)
  Development
   04380 Osteoclast differentiation
    100051798 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100051798 (MAPK8)
   05210 Colorectal cancer
    100051798 (MAPK8)
   05212 Pancreatic cancer
    100051798 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100051798 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100051798 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    100051798 (MAPK8)
   05133 Pertussis
    100051798 (MAPK8)
   05152 Tuberculosis
    100051798 (MAPK8)
   05164 Influenza A
    100051798 (MAPK8)
   05161 Hepatitis B
    100051798 (MAPK8)
   05160 Hepatitis C
    100051798 (MAPK8)
   05168 Herpes simplex infection
    100051798 (MAPK8)
   05169 Epstein-Barr virus infection
    100051798 (MAPK8)
   05145 Toxoplasmosis
    100051798 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    100051798 (MAPK8)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100051798 (MAPK8)
Protein kinases [BR:ecb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100051798 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 427 aa AA seqDB search
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaagcctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaagcgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaagtccctagaagaa
tttcaggatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctaggcatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttatcgaacag
cttggaacaccatgtcctgaattcatgaagaaactacagccaacagtaaggacttatgtc
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttattatccaaa
atgctggtgattgacgcgtctaaaaggatctctgtggatgaagcgctccagcacccgtac
atcaatgtctggtatgacccttcggaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacgatagaagagtggaaagaattgatatacaaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcgacagatccaactttggcctcggatacagacagcagtcttgaagcatctgct
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system