KEGG   Equus caballus (horse): 100051836Help
Entry
100051836         CDS       T01058                                 

Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00052  Galactose metabolism
ecb00500  Starch and sucrose metabolism
ecb00520  Amino sugar and nucleotide sugar metabolism
ecb00524  Neomycin, kanamycin and gentamicin biosynthesis
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb04910  Insulin signaling pathway
ecb04911  Insulin secretion
ecb04917  Prolactin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04930  Type II diabetes mellitus
ecb04950  Maturity onset diabetes of the young
ecb05230  Central carbon metabolism in cancer
Module
ecb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100051836
   00052 Galactose metabolism
    100051836
   00500 Starch and sucrose metabolism
    100051836
   00520 Amino sugar and nucleotide sugar metabolism
    100051836
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100051836
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100051836
   04910 Insulin signaling pathway
    100051836
   04922 Glucagon signaling pathway
    100051836
   04917 Prolactin signaling pathway
    100051836
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100051836
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100051836
   04950 Maturity onset diabetes of the young
    100051836
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100051836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 DUF4795
Motif
Other DBs
NCBI-GeneID: 100051836
NCBI-ProteinID: XP_023495909
Ensembl: ENSECAG00000022171
Position
4
AA seq 309 aa AA seqDB search
MAMDARRTQAQTTLNLVCWKRPVPTSPTHPRPLPVQAEQILAEFQLQEEDLKKVMRRMQE
EMDRGLRLETHEEATVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQW
SVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDI
DKGILLNWTKGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRR
CEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDAGELDEFLLEYDRVVDE
NSLNPGQQL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatgccaggaggacccaggcccagacaaccttgaatctggtgtgttggaaa
cgcccggttcccacctcccccacacacccgcgccctctccctgtgcaggcggagcagatc
ctggcagagttccagctgcaggaggaggacttgaagaaggtgatgaggcggatgcaggag
gagatggaccgaggcctgaggctagagacccacgaggaagccactgtgaagatgctgccc
acctacgtgcgctccaccccggaaggctcagaagtcggggacttcctctccctggacctg
ggcggcaccaacttcagggtgatgctggtgaaggtgggggagggcgaggcggggcagtgg
agtgtgaaaactaagcaccagatgtactccatccccgaggacgccatgacgggcaccgcc
gagatgctctttgactacatctccgagtgcatctctgacttcctggacaagcatcagatg
aagcacaagaagctgcccttgggcttcaccttctcctttcctgtgaggcatgaagacata
gacaagggcatccttctcaactggaccaagggcttcaaggcctctggagcagaagggaac
aacattgtggggctcctgcgagacgccatcaaacggagaggggactttgagatggacgtg
gtggcgatggtgaatgatactgtggccacaatgatctcctgctactacgaagaccgccgg
tgtgaggttggcatgattgtgggcaccggctgcaacgcctgctacatggaggagatgcag
aacgtggagctggtggaaggggacgagggccgcatgtgcgtcaacaccgagtggggcgcc
ttcggggacgcgggcgagctggacgagttcctgctggagtacgaccgcgtggtggacgag
aactccctgaaccctggccagcagctgtaa

DBGET integrated database retrieval system