KEGG   Equus caballus (horse): 100051890Help
Entry
100051890         CDS       T01058                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2 isoform X2
  KO
K05466  angiopoietin 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100051890 (ANGPT2)
   04015 Rap1 signaling pathway
    100051890 (ANGPT2)
   04010 MAPK signaling pathway
    100051890 (ANGPT2)
   04066 HIF-1 signaling pathway
    100051890 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100051890 (ANGPT2)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100051890 (ANGPT2)
Cytokines and growth factors [BR:ecb04052]
 Growth factors
  Growth factors (RTK binding)
   100051890 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Spc29
Motif
Other DBs
NCBI-GeneID: 100051890
NCBI-ProteinID: XP_001494170
Ensembl: ENSECAG00000015894
Position
27
AA seq 495 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKRQYQVQHGSCSYTFLLPETDNCRSSSSSY
VPNAVQRDAPPDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEMQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVN
NSVLQKQQHDLMETVHNLLTMISTPNSKNSFAAKEEQIIFRDCAEAFKSGLTTNGIYTLT
FPNSTEEIKAYCDMETGGGGWTIIQRREDGSVDFQRTWKEYKAGFGNPSGEYWLGNEFVS
QVTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEEFNYRIHLKGLTGTAGKISSISQPGN
DFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactttgagctgtgatcttgtcttagccgcagcctataac
aactttcggaaaagcatggacagcatagggaagagacagtatcaggttcagcacggctct
tgcagctacactttcctcctgcccgagacagacaactgccgctcttcttccagctcctac
gtcccgaatgccgtgcagagggacgcgccgccagactatgacgactctgtgcagagactg
caagtgctggagaacatcatggagaacaacacgcagtggctaatgaagcttgagaattat
atccaggacaatatgaagaaagaaatggtcgagatgcaacagaatgcagtacagaaccag
acggctgtgatgatagaaataggaaccaacctactaaaccaaaccgcagagcaaacaaga
aagttaactgatgttgaagcccaagtattaaatcagacaacaagacttgaacttcagctt
ctggaacattccctttctacaaacaaattggaaaaacagattttggatcagaccagtgaa
ataaacaaattgcaagataagaacagtttcctggaaaagaaagtactagatatggaagac
aagcacatagttcaacttcggtcaataaaagaagagaaagaccagctccaggtgttagta
tccaagcaaaattccatcattgaggaactagagaaacaattagtgactgcgactgtgaat
aattcagtcctccaaaagcagcaacatgatctgatggagacagttcataatttattgact
atgatatcgacacccaattctaagaactcctttgctgctaaggaggaacagatcatcttc
agagactgtgcggaagcattcaaatcaggactaacgaccaatggcatctacacgctaacg
ttccctaattccacggaggagataaaggcttactgtgacatggaaactggtggaggcggg
tggaccattatccagcgacgtgaagatggcagtgttgattttcagaggacgtggaaagaa
tataaagcgggatttgggaacccttcgggcgaatactggctgggaaatgagtttgtttca
caagtgactaatcagcaacgctacgtgcttaaaatacaccttaaagactgggaagggaac
gaggcttattcactgtacgaacacttctatctctcaagtgaagaattcaattacaggatt
caccttaaaggacttacagggacagccggcaaaataagcagcataagccaaccaggaaat
gattttagcacaaaggacgcagacaacgacaaatgtatttgcaaatgttcacaaatgctc
acaggaggctggtggtttgatgcatgtggtccctccaacttgaacggaatgtactaccca
cagaggcagaacacaaataaattcaacgggattaagtggtactattggaaaggatcgggc
tactcgctcaaggccacaaccatgatgatccgaccagcagatttctaa

DBGET integrated database retrieval system