KEGG   Equus caballus (horse): 100051890Help
Entry
100051890         CDS       T01058                                 

Gene name
ANGPT2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
ecb  Equus caballus (horse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100051890 (ANGPT2)
   04015 Rap1 signaling pathway
    100051890 (ANGPT2)
   04066 HIF-1 signaling pathway
    100051890 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100051890 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 444 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKRQYQVQHGSCSYTFLLPETDNCRSSSSSY
VPNAVQRDAPPDYDDSVQRLQVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEK
QILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEK
QLVTATVNNSVLQKQQHDLMETVHNLLTMISTPNSAKNSFAAKEEQIIFRDCAEAFKSGL
TTNGIYTLTFPNSTEEIKAYCDMETGGGGWTIIQRREDGSVDFQRTWKEYKAGFGNPSGE
YWLGNEFVSQVTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEEFNYRIHLKGLTGTAGK
ISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGI
KWYYWKGSGYSLKATTMMIRPADF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactttgagctgtgatcttgtcttagccgcagcctataac
aactttcggaaaagcatggacagcatagggaagagacagtatcaggttcagcacggctct
tgcagctacactttcctcctgcccgagacagacaactgccgctcttcttccagctcctac
gtcccgaatgccgtgcagagggacgcgccgccagactatgacgactctgtgcagagactg
caagtgctggagaacatcatggagaacaacacgcagtggctaatgaaggtattaaatcag
acaacaagacttgaacttcagcttctggaacattccctttctacaaacaaattggaaaaa
cagattttggatcagaccagtgaaataaacaaattgcaagataagaacagtttcctggaa
aagaaagtactagatatggaagacaagcacatagttcaacttcggtcaataaaagaagag
aaagaccagctccaggtgttagtatccaagcaaaattccatcattgaggaactagagaaa
caattagtgactgcgactgtgaataattcagtcctccaaaagcagcaacatgatctgatg
gagacagttcataatttattgactatgatatcgacacccaattcagctaagaactccttt
gctgctaaggaggaacagatcatcttcagagattgtgcagaagcattcaaatcaggacta
acgaccaatggcatctacacgctaacgttccctaattccacggaggagataaaggcttac
tgtgacatggaaactggtggaggcgggtggaccattatccagcgacgtgaagatggcagt
gttgattttcagaggacgtggaaagaatataaagcgggatttgggaacccttcgggcgaa
tactggctgggaaatgagtttgtttcacaagtgactaatcagcaacgctacgtgcttaaa
atacaccttaaagactgggaagggaacgaggcttattcactgtacgaacacttctatctc
tcaagtgaagaattcaattacaggattcaccttaaaggacttacagggacagccggcaaa
ataagcagcataagccaaccaggaaatgattttagcacaaaggacgcagacaacgacaaa
tgtatttgcaaatgttcacaaatgctcacaggaggctggtggtttgatgcatgtggtccc
tccaacttgaacggaatgtactacccacagaggcagaacacaaataaattcaacgggatt
aagtggtactactggaaaggatcgggctactcgctcaaggccacaaccatgatgatccga
ccagcagatttctaa

DBGET integrated database retrieval system