KEGG   Equus caballus (horse): 100052078Help
Entry
100052078         CDS       T01058                                 

Gene name
PDK4
Definition
pyruvate dehydrogenase kinase, isozyme 4
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 412 aa AA seqDB search
MKAARFVMRGAGSLSGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACEKTSFAFLRQE
LPVRLANILKEIDILPDPLVNTSSVQLVKSWYIQSLMDLVEFHEKSPEDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDGCTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPTHIGSIDPNCDVSAVVQDAFECSKMLCDQYYLTSPELKLTQVNGKFPGQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENWPSLTPIEVIVVLGNEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESVEKLPVFNKSAFKHYQMSSEADDWCVPSKEPRNLAKEKVAM
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgatgcgcggcgccggctcgctgagcggcgccggtctggtc
ccccgcgaggtcgagcatttctcgcgctacagcccgtccccgctgtccatgaagcagctg
ctggacttcggttccgaaaacgcatgtgaaaaaacttcttttgcatttttgcgacaagaa
ttgcctgtgaggctagccaatatcctgaaggaaattgatattctccctgatccattagtg
aatacatcttcagtgcaattagttaaaagctggtatatccagagcctgatggatttggtg
gaattccatgagaaaagcccagaggaccagaaagcattgtcagattttgtagatactctc
atcaaagttcgaaacagacaccataatgtagttcctacaatggcgcaaggaatcatagag
tataaagatggctgtacagttgacccagtcaccaatcaaaatcttcagtatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaacccacattggaagcattgatccaaactgtgacgtg
tcagcagtggtccaagatgcctttgagtgttcaaagatgctttgtgatcagtattattta
acatctccagaattaaagctcactcaagtgaatgggaaatttccaggccaaccaattcac
attgtgtacgtcccctctcaccttcatcatatgctctttgaactgttcaagaatgcaatg
agggcaacagttgaacaccaggaaaattggccttccctgacaccaattgaggtgattgtt
gtcttgggaaacgaagatcttacaattaagatttcagacagaggaggtggtgttcccctg
aggatcattgaccgcctctttagttacacatactccacggcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttatggcttgccaatttctcgtctctat
gccaagtactttcaaggagatctgaatctctactctttgtcgggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctgtggaaaaactcccagtctttaacaaa
tcagccttcaaacattatcagatgagtagtgaggctgacgactggtgtgtcccaagcaag
gaaccaaggaacctggcgaaggaaaaagtggccatgtaa

DBGET integrated database retrieval system