KEGG   Equus caballus (horse): 100052143Help
Entry
100052143         CDS       T01058                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:ecb04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 148 aa AA seqDB search
MKVLLTLGLLLLSVTVQGKVFERCELARTLKRLGLDGFRGVSLPNWVCLARWESNYNTRA
TNYNPGSQSTDYGIFQINSRYWCNDGKTPRAVNACRIPCSALLQDDITQAVACAKRVVSD
PQGIRAWVAWRNRCQNHDLTQYVKGCRV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctcctgactctggggcttctcctgctgtctgtcactgtccagggcaaggtc
tttgaaagatgtgagctggccagaacgctgaaaagacttggactggacggctttagggga
gtcagcctgccaaactgggtctgtttggccagatgggaaagtaattacaacacacgagct
acaaactacaatcctggaagtcaaagcactgattatgggatatttcagatcaacagccgc
tactggtgcaatgatggcaaaaccccacgagcagtgaatgcctgtcggattccctgcagc
gctctgctgcaagatgacatcactcaagccgtggcgtgtgcaaagcgggtggtcagtgac
ccacagggcatccgagcatgggtggcgtggagaaatcgttgtcagaaccacgacctcact
cagtatgtcaagggttgcagagtgtaa

DBGET integrated database retrieval system