KEGG   Equus caballus (horse): 100052261Help
Entry
100052261         CDS       T01058                                 

Gene name
PTPN7
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 7 isoform X1
  KO
K18019  tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100052261 (PTPN7)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100052261 (PTPN7)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100052261 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100052261
NCBI-ProteinID: XP_023488564
Ensembl: ENSECAG00000024331
Position
30
AA seq 446 aa AA seqDB search
MVQARGGPSRAQAPPSSLEAAMTQPPPTKAPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQHQPPSPKQLEEEFLKIPPNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYVRGYGGQEKAYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLRESKEKCVLYWPTEEDTYGPFRIRVQDVKEHPEYTVRQLSIQH
QEEHRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAANTGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRSVCLSSQGRDDPDHGAVPVPAPHLGPVRCP
AAGGAQPLTPDALHQPRRRLLPGLGRKLTSKDRGRSAGLHHWPVLSFLSWTLGANSHVPL
NLKIGGGVDNRSEIEAQGSGLLSNPL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtccaggcccgtggggggccctccagagcacaggcaccgccctcgtctttggaggca
gccatgacccagcctccacccaccaaagcgccagccaagaagcatgtgcggctgcaggag
aggcgaggctccaatgtcgctctgatgctggacgtgcggtccctgggggctgtggagccc
atctgctcagtgaacacaccccgggaggtcaccctacacttcctgcgcacagccggacac
cccctcacccgctgggccctgcagcaccagccgcccagccccaagcaactggaagaggaa
ttcttgaagatccccccaaactttgtgagccctgaagacctggacattcctggccacgcc
tccaaggaccgatacaagaccatcttgccaaatccccagagccgtgtctgtctaggccgg
gcacagagccaagaggatggagactatatcaacgccaactacgtccggggctacggcggg
caggagaaggcctacattgccacccagggccccatgcccaacaccgtgtcggacttctgg
gagatggtgtggcaggaagaagtgtcactcattgtcatgctcactcagctccgagagagc
aaggagaaatgtgtcctctactggcccacggaagaggacacctacggaccctttcggatt
cgcgtccaggatgtgaaagagcacccagaatacaccgtgcggcagctctccatccagcac
caggaggagcaccggtctgtgaagcacatcctcttctcggcctggcctgaccaccagacc
cccgagtcggcggggcccctgctgcgcctggtggccgaggtggaggagagcccagagacg
gccgccaacaccgggcccatcgtggtccactgcagtgcagggattggccggaccggctgt
ttcatcgccacccgaattggatgtcaacaactgaaggcccgaggggaagtagacattctg
ggcatcgtgtgccaactgcggctggacaggtctgtgtgcctctcctcccaggggcgggat
gatccagaccacggagcagtaccagttcctgcaccacaccttggccctgtacgctgccca
gctgccgggggagcccagcccctgacccccgacgccctccaccagcccaggcgccgactt
ctcccaggcctgggaaggaagctgaccagcaaggaccgaggccggagtgcaggtcttcac
cactggccagtcctctccttcctctcgtggacactaggggcaaactcccacgtccctctg
aacttaaagataggaggtggcgttgacaacaggtctgagatagaagcccaggggtctggt
cttctctcaaaccctctgtga

DBGET integrated database retrieval system