KEGG   Equus caballus (horse): 100052478Help
Entry
100052478         CDS       T01058                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 570 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEDFEGGGGGDGNMTQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLRYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSKGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIEKTLEEILSRLQEEEVERDRKLQTPPKGLLEKGPGVKRLSSLDDKIPPKSPRPRR
NIWLSRSQSDIFSRKPVNVLDPYYRPQQGDAARTPKINPFSARQDLKGGKIKFFDLPSKS
VISLVFDLDAPGPGTMPVADWQEPLAPPARRWRSLPGSPEFLHQEACPFVGREESLSDGP
PPRLSSLKYRVREIPPFRASALPAAPAHEAMDCSSLQEENGFGPRPQGASPCLAGTSEEM
EVEEERPRSLAPVPFSVSGIGLKTQGEQDG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtctggaa
gattttgaaggaggtggcggaggggatgggaacatgacccaggtgggaagggtttggcct
tcttcatatcgagctcttataagtgccttttccagactgacgcgtttagatgacttcacc
tgtgaaaaaatagggtctggcttcttctctgaagtgttcaaggtgcgccaccgagcttct
ggtcaggtgatggctcttaagatgaacacgttgaacagtaaccgggcgaacatgctgaaa
gaagtgcagctcatgaatagactctcccatcccaatatccttaggttcatgggtgtgtgt
gtacatcaaggacaattgcatgcacttacagagtatatcaactctggaaacctggaacag
ttgctagacagtaacctgcatttgccctggactgtgagggtgaaactggcctatgatata
gcagtgggtctccgctaccttcacttcaaaggcattttccatcgggacctcacgtctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtggctgactttggcctg
gctgagaagatccctgatgtcagcaaggggagtgagaagctggctgtggtgggctcaccc
ttctggatggcacctgaggttctccgagatgagccctacaatgagaaggcggacgtgttc
tcttatggtatcatcctctgtgagatcatcgcccgcatccaggctgatccggactatctt
ccccgtacagagaacttcgggctggactatgacgctttccagcatatggtgggagactgt
cctcccgactttctgcagctcaccttcaactgctgtaacatggatcccaaactgcgccca
tcctttgtggagattgagaagactttggaggaaattctgagccgcctacaggaggaagag
gtggagagggacaggaagctgcagaccccccccaagggactcttggagaaagggcctggg
gtgaagcgactgagttcactggatgacaagatccctcctaagtccccacgcccaagacgt
aatatctggctgtctcggagccagtcagacatcttctcccgtaagccagtgaatgtcttg
gacccctactaccggccacaacaaggtgatgctgcccgcacccccaaaatcaaccctttc
agtgctcgccaggacctcaagggtggcaagatcaagttctttgaccttcccagcaagtct
gtcatctccctggtatttgacctggatgcaccagggcctggaactatgcctgtggctgac
tggcaggagcccctggccccacctgctcgccggtggcgttctttgcctggttcaccagaa
ttcttgcatcaagaagcctgtccatttgtgggccgagaagaatcactatctgatgggccc
ccaccacgcctcagtagtctcaagtacagagtaagagagatcccgccattccgagcatct
gccctaccagctgctccagcccatgaggccatggactgctccagtctccaggaagaaaat
ggttttgggcccaggccccagggggccagtccatgcctcgcaggtacctctgaggaaatg
gaggtagaagaagaaagaccaagaagcttggctccagttcccttctctgtctcaggcata
ggcctgaaaacccagggagagcaggatgggtga

DBGET integrated database retrieval system