KEGG   Equus caballus (horse): 100052568Help
Entry
100052568         CDS       T01058                                 

Definition
histone H2B type 2-E-like
Orthology
K11252  
histone H2B
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ecb05322]
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccagctaaatccgcccctgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system