KEGG   Equus caballus (horse): 100052628Help
Entry
100052628         CDS       T01058                                 

Gene name
TACC3
Definition
(RefSeq) transforming, acidic coiled-coil containing protein 3
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
ecb  Equus caballus (horse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100052628 (TACC3)
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100052628 (TACC3)
   mRNA cycle factors
    P-body specific factors
     100052628 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 804 aa AA seqDB search
MLTKAVCFFRMSLQIFSDENVTGDKSAENCDFLFSPPELTGRSSVLRLSQKENVPPKSIA
KAVKVTFQTPLRDPQTHRVLSPVVSSKPEACFALGEARGLGNPPHVWTQKENQQLTKEVD
TKTTDGILQKPAVVDADPPPGNMRPASEDRHSGGPTSAPLALLNPSSSPQTLESLKNQVP
SPGRMSGSPEQDLEANVRSYSLEKSIMSTPEILEDPPGMVPQDRTADPHTVAGGSSHRIP
ASAAGATLPAGGAPEGAHGEGPLADLPGEAPADPENTTQAGPLGAGGTTSPSPQEEEADS
QKADSWRSGPIRLEFDFSDEAASKRPPPPRKLGKRPGLKAPSRRPEGRQEKSPREVGEGP
VPPPGGSYNLDCDKLDDPNVSPFGGGGEAWPSERPQDGSAGPGAAQLSTGPAAVENSPPN
QQVPSASADDTPVVQTAAETSGAVGKEGTVNSSGTLAPTSSPCSELTASPTKPASPPLQG
PEPASDLSDEHFRDPAEVLGAGAEVDYLEQFGTCLFKESALRKQSLYLKFDPLLMDSPQR
PAPVVPATDSVQDVDAPSGNPPAANLVELDFLGPPDVPVLDPPLCVLGPGGPLLPVGPIV
DVLQYSQKDLDAVVEATQKENLSLRSECEALQAKNLEMGKIMDGFERMVYQAMEEAQKQK
ELAKAEIQKVLKEKDQLTADLSSLEKSFSDLFKRFEKQKEVIEGYRTNEESLKKCVEDYI
VRIEKEGQRYYALKAHAEEKLKLANEEIAQVRSKAQAEALAFQASLRKEQMRIHSLEKTV
EQKTKENDELTRICDDLISKMEKI
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaaaggctgtctgctttttcagaatgagtctgcagatcttcagtgacgaaaat
gtcactggtgacaaaagtgcagagaactgtgacttcctgttttcaccaccagagcttacc
ggaagatcatctgttcttcgtctgtcacagaaagaaaatgtgccccccaagagcatagca
aaagctgtgaaggtgacttttcagacgcctctgcgggacccacagacgcacagggtttta
agtcctgttgtgagcagcaaaccggaggcttgctttgctctgggtgaggccagagggtta
ggaaaccctcctcacgtctggacgcagaaagagaaccaacagttgaccaaagaagtggac
accaaaacaaccgatggaattctccagaaaccagcagtggtggatgctgaccctcctcca
gggaacatgagaccagcctctgaagacaggcattctggcgggcccacctcagctcccctg
gccctcttgaatccctcaagctctccccagacgctggaaagtcttaaaaaccaagtgcca
tctccaggacgaatgtctggcagccctgagcaagacttggaggcaaacgttcgttcttat
tccttagagaaaagcattatgtccacccctgaaattctagaagaccctcctgggatggtg
ccccaagatagaactgcagaccctcacacagtggcaggaggaagctcgcacaggatccct
gcttccgcagccggggccactctgcctgctggaggtgcccccgaaggagcacatggagaa
gggccccttgcagacctgcctggcgaggcccctgccgaccccgagaataccacccaggct
ggccctctgggggctggaggcaccacgtccccaagtcctcaggaggaagaggccgacagc
caaaaggctgactcttggaggagcgggcccataaggctagaatttgacttctccgacgag
gctgccagcaaaaggccacccccaccaaggaagctggggaagagacctggcctcaaggct
ccctcacggaggccggaggggaggcaggaaaagagccccagggaggtgggtgagggtccc
gttccccctcccggggggtcttacaacctggactgcgacaagttggatgacccaaacgtc
agcccgtttggaggcggtggggaggcttggccctcagaacgcccccaggacggatccgcc
gggcccggggccgcacagctgagcactgggcctgcggccgtggagaactcacctccaaac
cagcaggtgccttcagcctccgcagatgacacacctgtggtgcagaccgcagcagagacc
tcaggagcagtcggcaaggaaggaactgtgaattcttcgggcacattggctcccaccagc
agtccatgcagtgagctgacggcctcacccactaaaccggcgtccccacctctgcagggg
ccagagccagcctcagacctgagtgacgagcacttccgagacccagctgaggttctaggt
gcaggagccgaggtggactacctggagcagttcgggacttgcttgtttaaagagtcagcc
ctgaggaagcagtccttatacctcaagttcgacccgctcctgatggacagccctcagaga
cctgcgcccgtggtccccgcgacagacagtgtgcaggacgtggacgcgccctcgggaaat
ccgcctgccgccaatctcgtggaacttgacttcctaggccctccggatgtgcctgtgctg
gacccacctttgtgtgtcctcgggcccgggggtccactgctgcccgtgggacccatcgtg
gacgtactacagtacagccagaaggacctggatgctgtggtggaagcaacacaaaaagag
aacctgtcgctcaggagcgagtgtgaggcgctccaggcgaagaacctggagatggggaag
atcatggatgggtttgagaggatggtgtaccaggcgatggaggaggctcagaaacagaag
gaacttgccaaagctgagatccagaaggttctcaaagagaaagaccaactgactgcagac
ctgagctccttggaaaagtctttctctgacctcttcaagcggttcgagaaacagaaggag
gtgatcgaaggctaccgcacgaatgaagaatcgctgaagaagtgcgttgaggattacata
gtgagaattgaaaaggaaggccagagatactacgcgctaaaggcccacgcggaagagaaa
ctcaagctggcaaacgaggagatcgcccaggtccggagcaaggcccaagcagaggccctg
gccttccaggcgagcctgaggaaggagcagatgcgcatccactcgctggagaagaccgtg
gagcagaagactaaagaaaacgatgagctgaccagaatctgtgacgacctcatatccaag
atggaaaagatctga

DBGET integrated database retrieval system