KEGG   Equus caballus (horse): 100052671Help
Entry
100052671         CDS       T01058                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00051  Fructose and mannose metabolism
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb01230  Biosynthesis of amino acids
Module
ecb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecb_M00002  Glycolysis, core module involving three-carbon compounds
ecb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100052671 (TPI1)
   00051 Fructose and mannose metabolism
    100052671 (TPI1)
   00562 Inositol phosphate metabolism
    100052671 (TPI1)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100052671 (TPI1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100052671 (TPI1)
  Exosomal proteins of bladder cancer cells
   100052671 (TPI1)
  Exosomal proteins of melanoma cells
   100052671 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100052671
NCBI-ProteinID: XP_001497522
Ensembl: ENSECAG00000015581
Position
6
AA seq 286 aa AA seqDB search
MAEAGQEAEFCLTALYISGPWPRLRAEPALQFAGPSAMAPSRKFFVGGNWKMNGRKKSLG
ELISTLNAAKVPADTEVVCAAPTAYIDFARQKLDHKIAVAAQNCYKVANGAFTGEISPGM
IKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKV
VFEQTKVIADNVKDWNKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQ
STRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggccggccaggaggcggagttctgcctcaccgcgctctacataagcgggccg
tggccgcggctgcgcgctgagcctgccctgcagttcgccggtcccagtgccatggcgccc
tccaggaagttcttcgtcggggggaactggaagatgaatggacggaagaagagtctgggg
gaactcatcagcactctgaacgcggccaaggtgccggccgacaccgaggtggtctgtgca
gcccccactgcctacattgacttcgcccgccagaagctagatcacaagattgctgtggct
gcgcagaactgctacaaagtggctaacggggcatttactggggagatcagccctggtatg
atcaaagactgtggagctacatgggtagtcctagggcactcagagagaaggcacgtcttt
ggggagtcagatgagctgattgggcagaaagtggcccatgccctggcggagggacttgga
gtaatcgcctgcatcggggagaagctagatgaaagggaagctggcatcactgagaaggtc
gttttcgagcaaaccaaggtcatcgcagataacgtcaaggactggaacaaggttgtgctg
gcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaacaggcccag
gaagtacacgaaaagctccggggatggcttaagtccaacgtctctgatgcagtggctcag
agcacccgcatcatttatggagggtctgtgactggggcaacctgcaaagagctggcaagc
cagcctgatgtggatggcttccttgtgggtggtgcttctctcaagcccgaattcgtggac
atcatcaatgccaaacaataa

DBGET integrated database retrieval system