KEGG   Equus caballus (horse): 100052671Help
Entry
100052671         CDS       T01058                                 

Gene name
TPI1
Definition
triosephosphate isomerase 1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100052671 (TPI1)
   01230 Biosynthesis of amino acids
    100052671 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100052671 (TPI1)
   00051 Fructose and mannose metabolism
    100052671 (TPI1)
   00562 Inositol phosphate metabolism
    100052671 (TPI1)
Enzymes [BR:ecb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100052671 (TPI1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100052671 (TPI1)
  Exosomal proteins of bladder cancer cells
   100052671 (TPI1)
  Exosomal proteins of melanoma cells
   100052671 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 286 aa AA seqDB search
MAEAGQEAEFCLTALYISGPWPRLRAEPALQFAGPSAMAPSRKFFVGGNWKMNGRKKSLG
ELISTLNAAKVPADTEVVCAAPTAYIDFARQKLDHKIAVAAQNCYKVANGAFTGEISPGM
IKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKV
VFEQTKVIADNVKDWNKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQ
STRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggccggccaggaggcggagttctgcctcaccgcgctctacataagcgggccg
tggccgcggctgcgcgctgagcctgccctgcagttcgccggtcccagtgccatggcgccc
tccaggaagttcttcgtcggggggaactggaagatgaatggacggaagaagagtctgggg
gaactcatcagcactctgaacgcggccaaggtgccggccgacaccgaggtggtctgtgca
gcccccactgcctacattgacttcgcccgccagaagctagatcacaagattgctgtggct
gcgcagaactgctacaaagtggctaacggggcatttactggggagatcagccctggtatg
atcaaagactgtggagctacatgggtagtcctagggcactcagagagaaggcacgtcttt
ggggagtcagatgagctgattgggcagaaagtggcccatgccctggcggagggacttgga
gtaatcgcctgcatcggggagaagctagatgaaagggaagctggcatcactgagaaggtc
gttttcgagcaaaccaaggtcatcgcagataacgtcaaggactggaacaaggttgtgctg
gcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaacaggcccag
gaagtacacgaaaagctccggggatggcttaagtccaacgtctctgatgcagtggctcag
agcacccgcatcatttatggagggtctgtgactggggcaacctgcaaagagctggcaagc
cagcctgatgtggatggcttccttgtgggtggtgcttctctcaagcccgaattcgtggac
atcatcaatgccaaacaataa

DBGET integrated database retrieval system