KEGG   Equus caballus (horse): 100052704Help
Entry
100052704         CDS       T01058                                 

Gene name
B3GALT4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
ecb  Equus caballus (horse)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ecb00514]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ecb00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 384 aa AA seqDB search
MPLSLFRRFLLAVLLLVIVWTLFGPSGIGEELLSLSLASLLPAPASPGPPLALPRLLIPN
EEACGGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGESSWRHLT
GVSHENDLARESAAQGDIVQAAFQDSYRNLTLKTLSGLNWADKHCPMARYILKTDDDVFV
NVPELVSELVRRGGRWEQWEKGMEPQRDPEVGHEEQEGGGPTLGSQPVPLLYLGRVHWWV
HPSRTPGAKHWISEEQWPPTWGPFPPYASGTGYVLSASAVQLVLKVASRAPLLPLEDVFV
GVSARRGGLTPTHCVKLAGATHYPLDRCCYGRFLLTSHRLDPWKMQEAWKLVGGSDGERT
APFCSWLEGVLGLLRCRVIAWLHS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagcctattccggcgctttctccttgccgtcctgctgctggtgattgtctgg
accctctttgggccctcaggcatcggggaggagctgctgagcctctcgctagcctccctg
ctcccagccccggcttcgcccggaccgcccctggccctgccccgcctcttaatccccaac
gaggaggcgtgcggtgggcccggcgcccctcccttcctgctaatcctcgtgtgcacggcc
ccggagaacctgaaccaaagaaacgccattcgagcctcgtggggcgggctgcgcgaggcc
cgagggctcagggtgcagactctttttcttctaggagaatcgagctggcggcatctcacc
ggggtctcccacgagaacgacctggcacgggagtcagcggcccagggggacatcgtgcag
gcggccttccaggactcctaccgaaaccttaccctcaagactctcagcgggctgaactgg
gccgacaaacactgccccatggcccgctacatcctcaagaccgacgatgatgtgtttgtg
aacgtcccggagcttgtatcagagctggtccggcgagggggccgttgggaacaatgggag
aagggcatggaaccacagagagaccctgaggttggacatgaagagcaggaaggcggcggc
cccactttggggagccagccagtgcctcttttgtacctgggacgtgtgcactggtgggtg
cacccctctcggaccccaggggctaagcactggatatcagaggagcagtggcctcccacc
tggggcccctttccaccctatgcctcaggcacaggctatgtgctgtcagcttctgctgtg
cagctcgtcctgaaggtggccagccgggcaccccttctgccactggaagatgtctttgtg
ggggtaagtgcccgacgaggaggcctcacaccaacccactgtgtcaagctggctggtgcc
acacactaccccctggaccggtgctgctatgggagattcctgctgacatcccacagattg
gacccctggaagatgcaagaagcctggaagctggtgggcggctctgatggggaaaggact
gcacccttctgctcctggcttgagggagtcctgggcctcctgcggtgtcgggtaatagcc
tggcttcacagctga

DBGET integrated database retrieval system