KEGG   Equus caballus (horse): 100052763Help
Entry
100052763         CDS       T01058                                 

Gene name
ALAD
Definition
(RefSeq) delta-aminolevulinic acid dehydratase isoform X1
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00860  Porphyrin and chlorophyll metabolism
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100052763 (ALAD)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100052763 (ALAD)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100052763 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 100052763
NCBI-ProteinID: XP_001488714
Ensembl: ENSECAG00000015427
UniProt: F6VCE9
Position
25
AA seq 329 aa AA seqDB search
MQPQSVLHSGYFHPLLRTWQAATTTLSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNR
LEEMLRPLVEEGLRCVLVFGVPSRVPKDERGSAADSEDSPTIEAVRLLRKTFPSLLVACD
VCLCPYTSHGHCGLLSENGAIQAKESRQRLAEVALAYAKAGCQVIAPSDMMDGRVEAIKD
ALMAHELGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADMLMVKPGMPYLDIVREVKNKHPELPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEAMTALRRAGADVIITYYTPLLLQWLKE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagtcggttctgcacagtggctacttccacccgctgcttcggacctggcag
gcggccaccaccaccctcagtgcctccaacctcatctaccccatctttgtcacggatgtt
cctgatgacgtgcagcctatcgccagcctcccaggagtggccaggtatggtgtgaaccgg
ctagaagagatgttgaggcccctggtggaagagggcctgcgttgtgtcctggtctttggt
gtccccagcagagttcccaaggacgagcggggctctgcagccgactctgaggactcccca
actattgaggcggtccgtctgttgcgcaagaccttccccagcctcctggtggcctgtgac
gtctgcctgtgcccctacacctcccatggtcactgcgggcttctgagcgagaacggggca
attcaagccaaggagagccgccagcggctggcagaggtggcactggcctatgccaaggca
ggatgtcaggtgatagccccgtcggacatgatggacggacgcgtggaagccatcaaggat
gctctgatggcacatgaacttggcaacagggtctccgtgatgagctatagtgccaagttt
gcttcctgtttctatggacctttccgggatgcggctcagtcaagcccagcctttggagac
cgccgctgctaccagctgccccccggagcacgaggcctggccctccgagcagtggaccgg
gatgtgcgggaaggagctgacatgctcatggtgaagccgggaatgccctacctggacatt
gtgcgggaagtgaagaacaagcaccctgagctccctctcgctgtgtaccacgtttctgga
gagtttgccatgctgtggcacggagcccaggccggggcgtttgatctcaaggctgccgtc
ctggaggccatgactgctttgcgcagagcaggtgctgacgtcatcatcacctactacaca
cctctgctcttgcagtggctgaaggagtga

DBGET integrated database retrieval system