KEGG   Equus caballus (horse): 100052937Help
Entry
100052937         CDS       T01058                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100052937 (ART1)
Cellular antigens [BR:ecb04090]
 Proteins
  100052937 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 326 aa AA seqDB search
MQTPVMLSLLLVSMGLMEALQAQSHRITRRDLFSKETPLDMAPASFDDQYVGCAAAMMAA
LPDLNYTEFQANKVYADGWALASSQWRERQAWGPEWGLSPTRLPPPPPGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRTRAHYLHHFSFXTLHFLLTEALQLLSRRQRSPRCHQVFRG
VHGLRFQPAGPGATVRLGGFASASLQNVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEE
VLIPPFETFQVINASRPAQGPARIYLRALGKRSTYNCEYIKDKQCKSGPCRLDNSAMGQG
PPSAFWSLLLLLWFLVVGAFPESTGL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcagactcccgtgatgctgtctctgctgcttgtgtccatgggcctcatggaggcgctc
caggcccagagccaccgcatcacacgacgagacctcttctctaaagaaactcccttggac
atggccccagcctcctttgacgaccagtacgttggctgtgcggcagccatgatggctgcc
ctcccggatctcaactacacggagttccaggccaacaaagtgtacgctgacggctgggcg
ctggcaagcagccaatggcgggaacgccaggcctgggggccagagtggggcctcagccct
acccgtctgcccccgccgccccccggcttccgcgatgagcacggggtggccctcctggcc
tacacagccaacagccccttgcacaaggagttcaacgcagccgtgcgcgaggcaggccgc
acccgggcccactacctccaccacttctccttcnagacgctccatttcctgctgacggag
gccctgcagctgctgagcaggcgccagcgttcgccccggtgccaccaggtgttccgcggg
gtacatgggctgcgcttccagccagcagggcccggggccaccgtcaggctggggggcttt
gcctccgcatccctgcagaacgttgcagcccagcagtttggtgaggacaccttctttggc
atctggacctgccttggggcccccatcaagggctactccttcttccctggggaggaggag
gtgctgatcccccccttcgagaccttccaggtgatcaatgccagcagaccggcccagggc
cccgcccgcatctacctccgggccctgggcaagcgcagcacgtacaactgtgagtacatc
aaagacaaacagtgcaagtctgggccctgccgtctggataactcagccatgggtcagggc
cccccttctgcattctggtcccttctgctgctgctctggttccttgtggtgggggccttt
ccagagagcacaggcctctga

DBGET integrated database retrieval system