KEGG   Equus caballus (horse): 100053056Help
Entry
100053056         CDS       T01058                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04015  Rap1 signaling pathway
ecb04218  Cellular senescence
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04668  TNF signaling pathway
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04912  GnRH signaling pathway
ecb05014  Amyotrophic lateral sclerosis (ALS)
ecb05145  Toxoplasmosis
ecb05164  Influenza A
ecb05167  Kaposi's sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05418  Fluid shear stress and atherosclerosis
Module
ecb_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100053056 (MAP2K6)
   04010 MAPK signaling pathway
    100053056 (MAP2K6)
   04668 TNF signaling pathway
    100053056 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100053056 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100053056 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100053056 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100053056 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100053056 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100053056 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100053056 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100053056 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100053056 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100053056 (MAP2K6)
   05169 Epstein-Barr virus infection
    100053056 (MAP2K6)
   05145 Toxoplasmosis
    100053056 (MAP2K6)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100053056 (MAP2K6)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: STE group
  STE7 family
   100053056 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase Choline_kinase DUF4344 APH
Motif
Other DBs
NCBI-GeneID: 100053056
NCBI-ProteinID: XP_001498802
Ensembl: ENSECAG00000010077
UniProt: F6QDN0
Position
11
AA seq 334 aa AA seqDB search
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGSQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccccggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacgccacctcgagatttagactccaaagcttgcatttct
attggaagtcagaactttgaggtgaaggcggatgacctggagcctatagtggaactggga
cgaggtgcgtacggggtagtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctattgatggatttg
gatatttccatgaggacagtggactgtccttttacagtcaccttttatggcgcactcttc
cgggagggtgatgtctggatctgcatggagctcatggatacgtcgctagataaattctac
aaacaagtgattgataaaggccaaacaattccagaagacatcttagggaaaatagccgtt
tcgattgtaaaagcattagaacatttacacagtaaactctctgtcattcatcgagacgtc
aagccttccaacgtgctgatcaatactctgggccaagtgaagatgtgtgattttggaatc
agtggctaccttgtagactctgttgctaaaaccattgatgcaggatgcaaaccatacatg
gctcctgaaagaataaaccccgagctcaaccagaagggatacagtgtgaagtctgacatc
tggagtctcggcatcacaatgattgagttggccatccttcggtttccttatgattcgtgg
ggaacgccttttcagcagctcaaacaggtggtagaggagccatcaccgcaactcccggca
gacaagttctccgaagagtttgttgactttacctcgcagtgcttgaagaagaattccaaa
gaacggccaacatatccagagcttatgcaacatccatttttcaccctacacgaatccaaa
gcaacagacgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system