KEGG   Equus caballus (horse): 100053057Help
Entry
100053057         CDS       T01058                                 

Gene name
KAT2A
Definition
(RefSeq) histone acetyltransferase KAT2A isoform X2
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04330  Notch signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05166  HTLV-I infection
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100053057 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100053057 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100053057 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100053057 (KAT2A)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100053057 (KAT2A)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100053057 (KAT2A)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100053057 (KAT2A)
   HAT complexes
    PCAF complex
     100053057 (KAT2A)
    STAGA complex
     100053057 (KAT2A)
    TFTC complex
     100053057 (KAT2A)
    SAGA complex
     100053057 (KAT2A)
    SLIK complex
     100053057 (KAT2A)
    ADA-HAT complex
     100053057 (KAT2A)
    HAT-A2 complex
     100053057 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 100053057
NCBI-ProteinID: XP_001495139
Ensembl: ENSECAG00000025059
Position
11
AA seq 837 aa AA seqDB search
MAEPSQASAPAPAVQPRTLQSPAPAPTPTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGSSNSSLS
LDSGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggcgtcggccccggctccggccgtacagccccgtacccttcag
tctccagccccggccccaactccgactcctgcccctagcccggcttcggccccgactccg
gctcccactccggcaccagcccccgccccagctgcagccccagccgggagcacagggacg
ggggggcccggggtaggaagtggggggaccgggagcgggggggatccggctcgacctggc
ctgagccagcagcagcgcgccagccagaggaaggcgcaagtccggggactgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgt
aatggctggaaaaaccccaagcccccgactgctcctcgcatggacctgcagcagccagct
gccaacctcagcgagctgtgccgcagctgtgaacaccccttggctgaccatgtgtcccac
ctggagaatgtgtcagaggatgagattaaccggcttctggggatggtggtggacgtggag
aatctgttcatgtctgttcacaaggaggaggacacagacactaaacaggtctatttctac
ctcttcaagctcctgcggaaatgcatcctgcagatgacccggcctgtggtggagggctcc
ctgggcagccccccatttgagaagcctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccgcgggagcggcagacgatgttcgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacgcctgcccagtttcggcagaggtct
caggccgaggacgtggctacctacaaggtcaactataccagatggctctgttactgccat
gtgccccagagctgcgatagcctcccccgctacgagaccactcacgtctttgggcgaagc
cttctccgctccatcttcactgtgacccggcggcagctgctggagaagttccgggtggag
aaagacaagctggtgcccgagaagaggaccctcatcctcacccacttccccaaattcctg
tccatgctggaggaggagatctatggggcaaactctccgatctgggaatcgggcttcacc
atgccgccctcagaggggacccagctggtgccccggccagctacagtcagcgcagctgtt
gttcccagtgcccccatcttcagccccaccatgggtgggagcagcaacagctccttgagt
ctggattctggaggggctgagcccatgccaggcgagaagaggaagctcccagagaacctg
accctggaggatgccaagcggctccgtgtgatgggcgacattcccatggagctggtcaac
gaggtcatgctcaccatcactgaccctgccgccatgctggggcccgagacgagcctgctg
tcagccaacgcagcccgggacgagacagcccgcctggaggagcgccgcggcatcatcgag
ttccatgtcatcggcaactcgctgacgcccaaggccaaccggcgggtgttgctctggctt
gtggggctgcagaatgtcttctcccaccagctgccgcgcatgcccaaggagtatatcgcc
cgcctcgtctttgacccgaagcataagactctggccttgatcaaggacgggcgggtcatt
ggtgggatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctccaatgagcaggtcaagggctatgggactcacctcatgaaccacctgaaggag
tatcacatcaaacacaacattctctacttcctcacctacgccgacgagtacgccatcggc
tactttaaaaagcagggcttctccaaggacatcaaggtgcccaagagccgctacctgggt
tatatcaaggactacgagggtgcaacactgatggagtgtgagctcaatcctcggatcccc
tacacggagctgtcccacatcatcaagaagcagaaggagatcatcaagaagctgattgag
cgcaaacaggcccagatccgaaaggtctatcccgggctcagctgcttcaaggaaggcgtg
aggcagatccctgtggagagcgtccctggcatccgagagacgggctggaagccgcttggg
aaggagaaggggaaggagctgaaggaccctgaccagctctatacaaccctcaaaaacctg
ctggcccagatcaagtcacaccccagtgcctggcccttcatggagcccgtgaagaagtcg
gaggccccagactactacgaggtcatccgcttccccatcgacctgaagaccatgacggag
cggctgcgcagccgctactatgtgacacggaagctctttgtggctgacctgcagcgggtc
atcgccaactgccgcgagtacaaccccccggacagcgagtactgccgctgcgccagtgcc
ctggagaagttcttctacttcaagctcaaggagggggggctcatcgacaagtag

DBGET integrated database retrieval system