KEGG   Equus caballus (horse): 100053170Help
Entry
100053170         CDS       T01058                                 

Gene name
HDAC9
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100053170 (HDAC9)
  Substance dependence
   05034 Alcoholism
    100053170 (HDAC9)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100053170 (HDAC9)
Chromosome [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100053170 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 437 aa AA seqDB search
MDGLEKHHLVSKTHSSPAASVLPHPAMDCPLQPGSATGIAYDPLMLKHQCICGNSTTHPE
HAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRT
LLGGASQKFFSSLPCGGIGVDSDTIWNELHSSGAARMAVGCVIELASRVASGELKNGFAV
VRPPGHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPS
ILYISLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDIEYLEAFRTVVT
PVAKEFDPDMVLVSAGFDALEGHAPPLGGYKVTAKCFGHLTKQLMTLADGHVVLALEGGH
DLTAICDASEACVNALLGNELEPLAEDILQQTPNMNAVISLQKIIEIQILTKVKLSPNDV
GIQQSFTGFKFVKRGKS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggatggattagagaaacatcatcttgtctccaagactcattcctctcctgctgcctcc
gttttacctcacccagcaatggactgcccccttcagcctggctctgcaactggaattgcc
tacgaccccctgatgctgaaacaccagtgcatttgtggtaattccaccactcaccctgag
catgctggacgaatacagagcatctggtcacggctgcaagaaacagggctgctaaataaa
tgtgagcgaattcaaggtcgaaaagccagcttggaggaaatacagcttgttcattctgaa
catcactcactgttgtacggcaccaaccccctggatggacagaagctggaccccaggaca
ctcctaggtggcgcttctcaaaagtttttttcttcattaccttgtggtggaattggggtg
gacagtgacaccatttggaatgagctccactcgtccggtgctgcacgcatggctgttggc
tgtgtcatcgagctggcttccagagtggcctcaggagagctgaagaatgggtttgctgtt
gtgaggccccctggccatcacgctgaagaatccacagccatggggttctgcttttttaat
tcggttgcaattaccgccaaatacttgagagaccaactaaatataagcaagatattgatt
gtagatctggatgttcaccatggaaacggtacacagcaggccttttatgctgaccccagc
atcctgtatatttcactccatcgctatgatgaagggaactttttccctggcagtggagcc
ccaaatgaggttggaacaggccttggagaaggatacaatataaacattgcctggacaggt
ggccttgatccccccatgggagatattgagtaccttgaagcattcaggactgtagtgacg
cctgtggccaaagagtttgatccagacatggtcctggtttctgctggatttgatgcatta
gaaggccacgcccctcctctgggcgggtacaaagtgacagcaaaatgctttggtcatttg
acgaagcagttgatgacactggccgatggacacgtggtgttggctctggaaggaggacat
gatctcacagccatctgcgatgcatcagaagcctgtgtaaatgcccttctaggaaatgag
ctggagccacttgcagaagatattctccagcaaaccccgaatatgaatgccgttatttct
ttacagaagatcattgaaattcaaatcttaactaaggttaagttatctcctaatgatgtt
ggaattcagcaatcatttactggttttaagtttgtcaagagaggaaaaagttaa

DBGET integrated database retrieval system