KEGG   Equus caballus (horse): 100053238Help
Entry
100053238         CDS       T01058                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 437 aa AA seqDB search
MYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGLVLSRTVHLELSFVCLGVGEKFSTW
EPTKRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDR
HRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLI
AALDVLHRHCKGDDNGKKANNPNHCSCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDIS
LDLPGSSTPFWPLSPGSEGSVVNGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHS
YQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNG
QYQQPMDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIEDVL
DSEGYLLFYHKQFLEYE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcggtatctactgctttttgtgtcaggactacatatatgacaaggacatggaa
atcattgccaaagaggagcagcggaaagcttggaaaatgcaaggtttggttctgtctaga
actgtgcatctggaactgtctttcgtctgcttaggcgttggagaaaagttttcaacttgg
gaaccaaccaaacgggagcttgaactgctgaaacacaaccccaaaaggcgcaagatcacc
tccaactgcaccataggtctgcgagggctcatcaaccttggcaatacctgcttcatgaac
tgcatcgtccaggcgctcacccacacgccgctgctgcgagacttcttcctctctgacagg
cacaggtgtgagatgcagagccccagctcctgcctggtctgcgagatgtcgtcacttttt
caggagttttactctgggcaccggtccccccacatcccgtacaagttgctgcacctggtg
tggactcacgcccggcacctggcaggctacgagcagcaggacgcccacgagttcctcatc
gcggccttggacgtcctgcaccggcactgcaaaggtgacgacaacgggaagaaggccaac
aaccccaaccactgcagctgcatcatagaccagatcttcacaggcggactgcagtcggac
gtcacctgccaggtctgccatggcgtctccaccacaatagatcccttctgggacatcagt
ttagatctgcctggctcttccacccccttctggcccctgagcccagggagcgagggtagc
gtggtgaacggggaaagccacgtctcaggaaccaccactctcacggactgcctgcgaaga
tttaccaggccagagcacttaggcagcagcgccaagatcaagtgtagcggctgccatagc
taccaggagtccaccaaacagctcaccatgaagaaactgcccatcgtggcctgtttccac
ctcaagcgattcgaacactcggccaaactgaggcggaagattaccacatacgtgtccttt
cccctggagctggacatgacccccttcatggcgtccagcaaagagagcaggatgaatgga
cagtaccagcagcccatggatagtctcaacaacgataacaagtactccttgtttgccgtt
gttaaccaccaggggaccctggagagcggccactacaccagcttcatcaggcagcacaag
gaccagtggttcaagtgtgacgatgccatcatcaccaaggccagcatcgaggacgtgcta
gacagtgaggggtacctgctgttctaccacaaacagttcctggagtacgagtaa

DBGET integrated database retrieval system