KEGG   Equus caballus (horse): 100053238Help
Entry
100053238         CDS       T01058                                 

Gene name
USP22
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 22
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100053238 (USP22)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100053238 (USP22)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100053238 (USP22)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100053238 (USP22)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     100053238 (USP22)
    SLIK complex
     100053238 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 100053238
NCBI-ProteinID: XP_023509457
Ensembl: ENSECAG00000021820
Position
11
AA seq 525 aa AA seqDB search
MGSRPEPDSEAMDAELVVTPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CVCHVCGVHLNRLHSCLHCVFFGCFTKKHIHEHAKSKRHHLAIELMYGGIYCFLCQDYIY
DKDMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCSCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVVNGESHVSGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPMDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIEDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccggcccgagccggacagcgaggccatggacgcggagctggtggtgacgccg
ccgggctgctcgcacctgggcagcttcaaggtggacaactggaagcagaacctgcgggcc
atctaccagtgcttcgtgtggagcggcacggccgaggcccgcaagcgcaaggcaaagtcg
tgcgtctgtcatgtttgtggtgtccacctgaacaggcttcactcttgcctccactgtgtc
ttcttcggctgtttcacaaagaaacatattcatgaacatgcgaagtcgaaacggcaccac
ctggccatagagcttatgtatggcggtatctactgctttttgtgtcaggactacatatat
gacaaggacatggaaatcattgccaaagaggagcagcggaaagcttggaaaatgcaaggc
gttggagaaaagttttcaacttgggaaccaaccaaacgggagcttgaactgctgaaacac
aaccccaaaaggcgcaagatcacctccaactgcaccataggtctgcgagggctcatcaac
cttggcaatacctgcttcatgaactgcatcgtccaggcgctcacccacacgccgctgctg
cgagacttcttcctctctgacaggcacaggtgtgagatgcagagccccagctcctgcctg
gtctgcgagatgtcgtcactttttcaggagttttactctgggcaccggtccccccacatc
ccgtacaagttgctgcacctggtgtggactcacgcccggcacctggcaggctacgagcag
caggacgcccacgagttcctcatcgcggccttggacgtcctgcaccggcactgcaaaggt
gacgacaacgggaagaaggccaacaaccccaaccactgcagctgcatcatagaccagatc
ttcacaggcggactgcagtcggacgtcacctgccaggtctgccatggcgtctccaccaca
atagatcccttctgggacatcagtttagatctgcctggctcttccacccccttctggccc
ctgagcccagggagcgagggtagcgtggtgaacggggaaagccacgtctcaggaaccacc
actctcacggactgcctgcgaagatttaccaggccagagcacttaggcagcagcgccaag
atcaagtgtagcggctgccatagctaccaggagtccaccaaacagctcaccatgaagaaa
ctgcccatcgtggcctgtttccacctcaagcgattcgaacactcggccaaactgaggcgg
aagattaccacatacgtgtcctttcccctggagctggacatgacccccttcatggcgtcc
agcaaagagagcaggatgaatggacagtaccagcagcccatggatagtctcaacaacgat
aacaagtactccttgtttgccgttgttaaccaccaggggaccctggagagcggccactac
accagcttcatcaggcagcacaaggaccagtggttcaagtgtgacgatgccatcatcacc
aaggccagcatcgaggacgtgctagacagtgaggggtacctgctgttctaccacaaacag
ttcctggagtacgagtaa

DBGET integrated database retrieval system